Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using DPPA2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Rabbit DPPA2 Polyclonal Antibody | anti-DPPA2 antibody
DPPA2 Polyclonal Antibody
Gene Names
DPPA2; CT100; PESCRG1; ECAT15-2
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
DPPA2; Polyclonal Antibody; DPPA2 Polyclonal Antibody; CT100; ECAT15-2; PESCRG1; anti-DPPA2 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
MSDANLDSSKKNFLEGEVDDEESVILTLVPVKDDANMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPLPTILPPINKVCRDTLRDWCQQLGLSTNGKKIEVYLRLHRHAYPEQRQDMPEMSQETRLQRCSRKRKAVTKRARLQRSYEMNERAEETNTVEVITSAPGAMLASWARIAARAVQPK
Sequence Length
298
Applicable Applications for anti-DPPA2 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human DPPA2
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Nucleus
Positive Samples
SH-SY5Y, Jurkat, Mouse ovary, Mouse uterus, Rat ovary, Rat uterus
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using DPPA2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using DPPA2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Product Categories/Family for anti-DPPA2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 33kDa
Observed: 34kDa
Observed: 34kDa
NCBI Official Full Name
developmental pluripotency-associated protein 2
NCBI Official Synonym Full Names
developmental pluripotency associated 2
NCBI Official Symbol
DPPA2
NCBI Official Synonym Symbols
CT100; PESCRG1; ECAT15-2
NCBI Protein Information
developmental pluripotency-associated protein 2
UniProt Protein Name
Developmental pluripotency-associated protein 2
Protein Family
UniProt Gene Name
DPPA2
UniProt Synonym Gene Names
PESCRG1
Uniprot Description
Binds to target gene promoters, including NKX2-5 and SYCE1, but not GATA4, and may be involved in the maintenance of the active epigenetic status of these genes.
Research Articles on DPPA2
Similar Products
Product Notes
The DPPA2 dppa2 (Catalog #AAA9134957) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DPPA2 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DPPA2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the DPPA2 dppa2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSDANLDSSK KNFLEGEVDD EESVILTLVP VKDDANMEQM EPSVSSTSDV KLEKPKKYNP GHLLQTNEQF TAPQKARCKI PALPLPTILP PINKVCRDTL RDWCQQLGLS TNGKKIEVYL RLHRHAYPEQ RQDMPEMSQE TRLQRCSRKR KAVTKRARLQ RSYEMNERAE ETNTVEVITS APGAMLASWA RIAARAVQPK. It is sometimes possible for the material contained within the vial of "DPPA2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
