Western Blot (WB)
(Western blot analysis of extracts of Mouse thymus, using DPH2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 300s.)
Rabbit anti-Mouse DPH2 Polyclonal Antibody | anti-DPH2 antibody
DPH2 Rabbit pAb
Gene Names
DPH2; DPH2L2
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
DPH2; Polyclonal Antibody; DPH2 Rabbit pAb; DPH2L2; anti-DPH2 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
VAFVLRQRSVALELCVKAFEAQNPDPKAPVVLLSEPACAHALEALATLLRPRYLDLLVSSPAFPQPVGSLSPEPMPLERFGRRFPLAPGRRLEEYGAFYVGGSKASPDPDLDPDLSRLLLGWAPGQPFSSCCPDTGKTQDEGARAGRLRARRRYLVERARDARVVGLLAGTLGVAQHREALAHLRNLTQAAGKRSYVLALGRPTPAKLANF
Applicable Applications for anti-DPH2 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 120-330 of human DPH2 (NP_001375.2).
Positive Samples
Mouse thymus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of Mouse thymus, using DPH2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 300s.)
Western Blot (WB)
(Western blot analysis of extracts of Mouse thymus, using DPH2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 300s.)
Related Product Information for anti-DPH2 antibody
Background: This gene is one of two human genes similar to the yeast gene dph2. The yeast gene was identified by its ability to complement a diphthamide mutant strain, and thus probably functions in diphthamide biosynthesis. Diphthamide is a post-translationally modified histidine residue present in elongation factor 2 (EF2) that is the target of diphtheria toxin ADP-ribosylation. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2016]
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
38,510 Da
NCBI Official Full Name
2-(3-amino-3-carboxypropyl)histidine synthase subunit 2
NCBI Official Synonym Full Names
DPH2 homolog
NCBI Official Symbol
DPH2
NCBI Official Synonym Symbols
DPH2L2
NCBI Protein Information
2-(3-amino-3-carboxypropyl)histidine synthase subunit 2; diphthamide biosynthesis protein 2
UniProt Protein Name
2-(3-amino-3-carboxypropyl)histidine synthase subunit 2
Protein Family
UniProt Gene Name
DPH2
UniProt Synonym Gene Names
DPH2L2
NCBI Description
This gene is one of two human genes similar to the yeast gene dph2. The yeast gene was identified by its ability to complement a diphthamide mutant strain, and thus probably functions in diphthamide biosynthesis. Diphthamide is a post-translationally modified histidine residue present in elongation factor 2 (EF2) that is the target of diphtheria toxin ADP-ribosylation. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2016]
Uniprot Description
Required for the first step in the synthesis of diphthamide, a post-translational modification of histidine which occurs in translation elongation factor 2 (EEF2).
Research Articles on DPH2
Similar Products
Product Notes
The DPH2 dph2 (Catalog #AAA9142786) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DPH2 Rabbit pAb reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's DPH2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the DPH2 dph2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VAFVLRQRSV ALELCVKAFE AQNPDPKAPV VLLSEPACAH ALEALATLLR PRYLDLLVSS PAFPQPVGSL SPEPMPLERF GRRFPLAPGR RLEEYGAFYV GGSKASPDPD LDPDLSRLLL GWAPGQPFSS CCPDTGKTQD EGARAGRLRA RRRYLVERAR DARVVGLLAG TLGVAQHREA LAHLRNLTQA AGKRSYVLAL GRPTPAKLAN F. It is sometimes possible for the material contained within the vial of "DPH2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
