Western Blot (WB)
(DONSON antibody - middle region validated by WB using Mouse brains at 1:1000.)
Rabbit DONSON Polyclonal Antibody | anti-DONSON antibody
DONSON antibody - middle region
Gene Names
DONSON; B17; MIMIS; MISSLA; C21orf60
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DONSON; Polyclonal Antibody; DONSON antibody - middle region; anti-DONSON antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEE
Sequence Length
566
Applicable Applications for anti-DONSON antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DONSON
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(DONSON antibody - middle region validated by WB using Mouse brains at 1:1000.)
Western Blot (WB)
(DONSON antibody - middle region validated by WB using Mouse brains at 1:1000.)
Western Blot (WB)
(WB Suggested Anti-DONSON Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateDONSON is supported by BioGPS gene expression data to be expressed in HepG2)
Western Blot (WB)
(WB Suggested Anti-DONSON Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysateDONSON is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-DONSON antibody
This is a rabbit polyclonal antibody against DONSON. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: This gene lies downstream of the SON gene and spans 10 kb on chromosome 21. The function of this gene is unknown.This gene lies downstream of the SON gene and spans 10 kb on chromosome 21. The function of this gene is unknown.
Target Description: This gene lies downstream of the SON gene and spans 10 kb on chromosome 21. The function of this gene is unknown.This gene lies downstream of the SON gene and spans 10 kb on chromosome 21. The function of this gene is unknown.
Product Categories/Family for anti-DONSON antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63kDa
NCBI Official Full Name
protein downstream neighbor of Son
NCBI Official Synonym Full Names
downstream neighbor of SON
NCBI Official Symbol
DONSON
NCBI Official Synonym Symbols
B17; MIMIS; MISSLA; C21orf60
NCBI Protein Information
protein downstream neighbor of Son
UniProt Protein Name
Protein downstream neighbor of Son
Protein Family
UniProt Gene Name
DONSON
UniProt Synonym Gene Names
C21orf60
UniProt Entry Name
DONS_HUMAN
NCBI Description
This gene lies downstream of the SON gene and spans 10 kb on chromosome 21. The function of this gene is unknown. [provided by RefSeq, Jul 2008]
Research Articles on DONSON
Similar Products
Product Notes
The DONSON donson (Catalog #AAA3207947) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DONSON antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DONSON can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DONSON donson for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DLITALISPT TRGLREAMRN EGIEFSLPLI KESGHKKETA SGTSLGYGEE. It is sometimes possible for the material contained within the vial of "DONSON, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
