Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DOK2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

Rabbit DOK2 Polyclonal Antibody | anti-DOK2 antibody

DOK2 antibody - C-terminal region

Gene Names
DOK2; p56DOK; p56dok-2
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DOK2; Polyclonal Antibody; DOK2 antibody - C-terminal region; anti-DOK2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QEPRGEAWRRQATRDRDPAGLQHVQPAGQDFSASGWQPGTEYDNVVLKKG
Sequence Length
412
Applicable Applications for anti-DOK2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 90%; Horse: 90%; Human: 100%; Mouse: 90%; Pig: 100%; Rat: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human DOK2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DOK2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-DOK2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysate)
Related Product Information for anti-DOK2 antibody
This is a rabbit polyclonal antibody against DOK2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DOK2 is constitutively tyrosine phosphorylated in hematopoietic progenitors isolated from chronic myelogenous leukemia (CML) patients in the chronic phase. It may be a critical substrate for p210 (bcr/abl), a chimeric protein whose presence is associated with CML. DOK2 binds p120 (RasGAP) from CML cells.The protein encoded by this gene is constitutively tyrosine phosphorylated in hematopoietic progenitors isolated from chronic myelogenous leukemia (CML) patients in the chronic phase. It may be a critical substrate for p210(bcr/abl), a chimeric protein whose presence is associated with CML. This encoded protein binds p120 (RasGAP) from CML cells.
Product Categories/Family for anti-DOK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
docking protein 2 isoform a
NCBI Official Synonym Full Names
docking protein 2
NCBI Official Symbol
DOK2
NCBI Official Synonym Symbols
p56DOK; p56dok-2
NCBI Protein Information
docking protein 2
UniProt Protein Name
Docking protein 2
Protein Family
UniProt Gene Name
DOK2
UniProt Entry Name
DOK2_HUMAN

NCBI Description

The protein encoded by this gene is constitutively tyrosine phosphorylated in hematopoietic progenitors isolated from chronic myelogenous leukemia (CML) patients in the chronic phase. It may be a critical substrate for p210(bcr/abl), a chimeric protein whose presence is associated with CML. This encoded protein binds p120 (RasGAP) from CML cells. [provided by RefSeq, Jul 2008]

Uniprot Description

DOK2: a member of the p62dok family of proteins that interact with receptor tyrosine kinases and mediate particular biological responses. Constitutively tyrosine phosphorylated in hematopoietic progenitors isolated from chronic myelogenous leukemia (CML) patients in the chronic phase. It may be a critical substrate for p210(bcr/Abl), a chimeric protein whose presence is associated with CML. Contains a pleckstrin homology domain at the amino terminus, 13 potential tyrosine phosphorylation sites, and six PXXP SH3 recognition motifs. Binds p120 (RasGAP) from CML cells.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 8p21.3

Cellular Component: cytosol

Molecular Function: receptor signaling protein activity; transmembrane receptor protein tyrosine kinase adaptor protein activity; insulin receptor binding

Biological Process: cell surface receptor linked signal transduction; Ras protein signal transduction; blood coagulation; signal transduction; leukocyte migration; transmembrane receptor protein tyrosine kinase signaling pathway

Research Articles on DOK2

Similar Products

Product Notes

The DOK2 dok2 (Catalog #AAA3224444) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DOK2 antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DOK2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DOK2 dok2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QEPRGEAWRR QATRDRDPAG LQHVQPAGQD FSASGWQPGT EYDNVVLKKG. It is sometimes possible for the material contained within the vial of "DOK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.