Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DOCK2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: THP-1 cell lysate)

Rabbit DOCK2 Polyclonal Antibody | anti-DOCK2 antibody

DOCK2 antibody - middle region

Gene Names
DOCK2; IMD40
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DOCK2; Polyclonal Antibody; DOCK2 antibody - middle region; anti-DOCK2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ALALSVAGIPGLDEANTSPRLSQTFLQLSDGDKKTLTRKKVNQFFKTMLA
Sequence Length
1830
Applicable Applications for anti-DOCK2 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 79%; Guinea Pig: 92%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DOCK2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DOCK2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: THP-1 cell lysate)

Western Blot (WB) (WB Suggested Anti-DOCK2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: THP-1 cell lysate)
Related Product Information for anti-DOCK2 antibody
This is a rabbit polyclonal antibody against DOCK2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The DOCK2 gene encodes a hematopoietic cell-specific CDM family protein that is indispensable for lymphocyte chemotaxis.
Product Categories/Family for anti-DOCK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
212kDa
NCBI Official Full Name
dedicator of cytokinesis protein 2
NCBI Official Synonym Full Names
dedicator of cytokinesis 2
NCBI Official Symbol
DOCK2
NCBI Official Synonym Symbols
IMD40
NCBI Protein Information
dedicator of cytokinesis protein 2
UniProt Protein Name
Dedicator of cytokinesis protein 2
UniProt Gene Name
DOCK2
UniProt Synonym Gene Names
KIAA0209
UniProt Entry Name
DOCK2_HUMAN

NCBI Description

The protein encoded by this gene belongs to the CDM protein family. It is specifically expressed in hematopoietic cells and is predominantly expressed in peripheral blood leukocytes. The protein is involved in remodeling of the actin cytoskeleton required for lymphocyte migration in response to chemokine signaling. It activates members of the Rho family of GTPases, for example RAC1 and RAC2, by acting as a guanine nucleotide exchange factor (GEF) to exchange bound GDP for free GTP. Mutations in this gene result in immunodeficiency 40 (IMD40), a combined form of immunodeficiency that affects T cell number and function, also with variable defects in B cell and NK cell function. [provided by RefSeq, May 2018]

Research Articles on DOCK2

Similar Products

Product Notes

The DOCK2 dock2 (Catalog #AAA3210580) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DOCK2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DOCK2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DOCK2 dock2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ALALSVAGIP GLDEANTSPR LSQTFLQLSD GDKKTLTRKK VNQFFKTMLA. It is sometimes possible for the material contained within the vial of "DOCK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.