Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: DNMT3ASample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

Rabbit DNMT3B Polyclonal Antibody | anti-DNMT3B antibody

DNMT3B Antibody - C-terminal region

Gene Names
DNMT3B; ICF; ICF1; M.HsaIIIB
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DNMT3B; Polyclonal Antibody; DNMT3B Antibody - C-terminal region; anti-DNMT3B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: STVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKE
Sequence Length
351
Applicable Applications for anti-DNMT3B antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human DNMT3B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: DNMT3ASample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: DNMT3ASample Tissue: Mouse SpleenAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: DNMT3ASample Type: Lung Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: DNMT3ASample Type: Lung Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-DNMT3B antibody
This is a rabbit polyclonal antibody against DNMT3A. It was validated on Western Blot

Target Description: CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase which is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes primarily to the nucleus and its expression is developmentally regulated. Mutations in this gene cause the immunodeficiency-centromeric instability-facial anomalies (ICF) syndrome. Eight alternatively spliced transcript variants have been described. The full length sequences of variants 4 and 5 have not been determined.
Product Categories/Family for anti-DNMT3B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
DNA (cytosine-5)-methyltransferase 3B isoform 7
NCBI Official Synonym Full Names
DNA methyltransferase 3 beta
NCBI Official Symbol
DNMT3B
NCBI Official Synonym Symbols
ICF; ICF1; M.HsaIIIB
NCBI Protein Information
DNA (cytosine-5)-methyltransferase 3B
UniProt Protein Name
DNA (cytosine-5)-methyltransferase 3B
Protein Family
DNA
UniProt Gene Name
DNMT3B
UniProt Synonym Gene Names
Dnmt3b; DNA MTase HsaIIIB; M.HsaIIIB
UniProt Entry Name
DNM3B_HUMAN

NCBI Description

CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase which is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes primarily to the nucleus and its expression is developmentally regulated. Mutations in this gene cause the immunodeficiency-centromeric instability-facial anomalies (ICF) syndrome. Eight alternatively spliced transcript variants have been described. The full length sequences of variants 4 and 5 have not been determined. [provided by RefSeq, May 2011]

Uniprot Description

DNMT3B: a ubiquitous DNA methyltransferase required for genome wide de novo methylation and essential for development. DNA methylation is coordinated with methylation of histones. Numerous cancer cell lines and primary acute leukemias express aberrant DNMT3B transcripts, especially DNMT3B7. Transfection of DNMT3B7 into 293 cells alters the pattern of genes expressed in the transfected cells. Can interact with DNMT1, which might be a co-operative event during DNA methylation. Methylates CpG sites at a rate slower than DNMT3A and much slower than DNMT1. Interacts with SUV39H1, SETDB1, SUMO1 and UBE2I9. Interacts with DNMT1 and DNMT3A. Mutations in DNMT3B have been shown to cause immunodeficiency-centromeric instability-facial anomalies syndrome (ICF). Six alternatively spliced isoforms of the human protein have been reported. Isoform 1 is expressed in all tissues except brain, skeletal muscle and PBMC, 3 is ubiquitous, 4 is expressed in all tissues except brain, skeletal muscle, lung and prostate and 5 is detectable only in testis and at very low level in brain and prostate. Isoforms 4 and 5 are probably not enzymatically active due to the deletion of two conserved methyltransferase motifs.

Protein type: Methyltransferase; Methyltransferase, DNA; Cell development/differentiation; EC 2.1.1.37; Amino Acid Metabolism - cysteine and methionine

Chromosomal Location of Human Ortholog: 20q11.2

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; cytoplasm; nuclear heterochromatin; nucleus

Molecular Function: DNA (cytosine-5-)-methyltransferase activity; protein binding; unmethylated CpG binding; DNA (cytosine-5-)-methyltransferase activity, acting on CpG substrates; metal ion binding; DNA-methyltransferase activity; transcription corepressor activity

Biological Process: response to drug; negative regulation of histone H3-K9 methylation; genetic imprinting; S-adenosylhomocysteine metabolic process; positive regulation of histone H3-K4 methylation; negative regulation of transcription from RNA polymerase II promoter; regulation of gene expression, epigenetic; cytosine methylation within a CG sequence; protein complex localization; methylation-dependent chromatin silencing; negative regulation of gene expression, epigenetic; DNA methylation; S-adenosylmethioninamine metabolic process; gene expression; response to ionizing radiation; positive regulation of neuron differentiation; DNA methylation on cytosine

Disease: Immunodeficiency-centromeric Instability-facial Anomalies Syndrome 1

Research Articles on DNMT3B

Similar Products

Product Notes

The DNMT3B dnmt3b (Catalog #AAA3209222) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DNMT3B Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's DNMT3B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DNMT3B dnmt3b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: STVNDKLELQ ECLEHGRIAK FSKVRTITTR SNSIKQGKDQ HFPVFMNEKE. It is sometimes possible for the material contained within the vial of "DNMT3B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.