Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using DNMT3A antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Rabbit DNMT3A Polyclonal Antibody | anti-DNMT3A antibody
DNMT3A Rabbit pAb
Gene Names
DNMT3A; DNMT3A2; M.HsaIIIA
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
DNMT3A; Polyclonal Antibody; DNMT3A Rabbit pAb; DNMT3A2; M.HsaIIIA; TBRS; anti-DNMT3A antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
SVTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMIDAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLL
Applicable Applications for anti-DNMT3A antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 500-700 of human DNMT3A (NP_715640.2).
Cellular Location
Cytoplasm, Nucleus
Positive Samples
293T, A-549, Mouse thymus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using DNMT3A antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using DNMT3A antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-DNMT3A antibody
Background: CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase that is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes to the cytoplasm and nucleus and its expression is developmentally regulated.
Product Categories/Family for anti-DNMT3A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
102kDa
NCBI Official Full Name
DNA (cytosine-5)-methyltransferase 3A isoform a
NCBI Official Synonym Full Names
DNA (cytosine-5-)-methyltransferase 3 alpha
NCBI Official Symbol
DNMT3A
NCBI Official Synonym Symbols
DNMT3A2; M.HsaIIIA
NCBI Protein Information
DNA (cytosine-5)-methyltransferase 3A; DNA (cytosine-5)-methyltransferase 3A; DNA MTase HsaIIIA; DNA cytosine methyltransferase 3A2
UniProt Protein Name
DNA (cytosine-5)-methyltransferase 3A
Protein Family
UniProt Gene Name
DNMT3A
UniProt Synonym Gene Names
Dnmt3a; DNA MTase HsaIIIA; M.HsaIIIA
UniProt Entry Name
DNM3A_HUMAN
Similar Products
Product Notes
The DNMT3A dnmt3a (Catalog #AAA9142481) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DNMT3A Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DNMT3A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the DNMT3A dnmt3a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SVTQKHIQEW GPFDLVIGGS PCNDLSIVNP ARKGLYEGTG RLFFEFYRLL HDARPKEGDD RPFFWLFENV VAMGVSDKRD ISRFLESNPV MIDAKEVSAA HRARYFWGNL PGMNRPLAST VNDKLELQEC LEHGRIAKFS KVRTITTRSN SIKQGKDQHF PVFMNEKEDI LWCTEMERVF GFPVHYTDVS NMSRLARQRL L. It is sometimes possible for the material contained within the vial of "DNMT3A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
