Western Blot (WB)
(WB Suggested Anti-DLK1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Stomach)
Rabbit DLK1 Polyclonal Antibody | anti-DLK1 antibody
DLK1 antibody - middle region
Gene Names
DLK1; DLK; FA1; ZOG; pG2; DLK-1; PREF1; Delta1; Pref-1
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DLK1; Polyclonal Antibody; DLK1 antibody - middle region; anti-DLK1 antibody
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLT
Sequence Length
383
Applicable Applications for anti-DLK1 antibody
Western Blot (WB)
Homology
Dog: 93%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rat: 100%; Sheep: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DLK1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-DLK1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Stomach)
Western Blot (WB)
(WB Suggested Anti-DLK1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Stomach)
Related Product Information for anti-DLK1 antibody
This is a rabbit polyclonal antibody against DLK1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: DLK1 may have a role in neuroendocrine differentiation.
Target Description: DLK1 may have a role in neuroendocrine differentiation.
Product Categories/Family for anti-DLK1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
protein delta homolog 1 isoform 1 preproprotein
NCBI Official Synonym Full Names
delta like non-canonical Notch ligand 1
NCBI Official Symbol
DLK1
NCBI Official Synonym Symbols
DLK; FA1; ZOG; pG2; DLK-1; PREF1; Delta1; Pref-1
NCBI Protein Information
protein delta homolog 1
UniProt Protein Name
Protein delta homolog 1
Protein Family
UniProt Gene Name
DLK1
UniProt Synonym Gene Names
DLK; DLK-1; FA1
UniProt Entry Name
DLK1_HUMAN
NCBI Description
This gene encodes a transmembrane protein that contains multiple epidermal growth factor repeats that functions as a regulator of cell growth. The encoded protein is involved in the differentiation of several cell types including adipocytes. This gene is located in a region of chromosome 14 frequently showing unparental disomy, and is imprinted and expressed from the paternal allele. A single nucleotide variant in this gene is associated with child and adolescent obesity and shows polar overdominance, where heterozygotes carrying an active paternal allele express the phenotype, while mutant homozygotes are normal. [provided by RefSeq, Nov 2015]
Research Articles on DLK1
Similar Products
Product Notes
The DLK1 dlk1 (Catalog #AAA3208181) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DLK1 antibody - middle region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's DLK1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DLK1 dlk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SPQQVTRLPS GYGLAYRLTP GVHELPVQQP EHRILKVSMK ELNKKTPLLT. It is sometimes possible for the material contained within the vial of "DLK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
