Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence analysis of HeLa cells using DLGAP5 antibody. Blue: DAPI for nuclear staining.)

Rabbit anti-Human, Mouse DLGAP5 Polyclonal Antibody | anti-DLGAP5 antibody

DLGAP5 Polyclonal Antibody

Gene Names
DLGAP5; DLG7; HURP
Reactivity
Human, Mouse
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purification
Synonyms
DLGAP5; Polyclonal Antibody; DLGAP5 Polyclonal Antibody; DLG7; HURP; anti-DLGAP5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
KNVFRKKVVSGIASKPKQDDAGRIAARNRLAAIKNAMRERIRQEECAETAVSVIPKEVDKIVFDAGFFRVESPVKLFSGLSVSSEGPSQRLGTPKSVNKAVSQSRNEMGIPQQTTSPENAGPQNTKSEHVKKTLFLSIPESRSSIEDAQCPGLPDLIEENHVVNKTDLKVDCLSSERMSLPLLAGGVADDINTNKKEGISDVVEGMELNSSITSQDVLMSSPEKNTASQNSILEEGETKISQSELFDNKSLTTEC
Sequence Length
842
Applicable Applications for anti-DLGAP5 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
WB: 1:500 - 1:2000
IF: 1:50 - 1:200
Immunogen
Recombinant protein of human DLGAP5
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm, Nucleus, cytoskeleton, spindle
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

Immunofluorescence (IF)

(Immunofluorescence analysis of HeLa cells using DLGAP5 antibody. Blue: DAPI for nuclear staining.)

Immunofluorescence (IF) (Immunofluorescence analysis of HeLa cells using DLGAP5 antibody. Blue: DAPI for nuclear staining.)
Product Categories/Family for anti-DLGAP5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
85kDa/94kDa/95kDa
NCBI Official Full Name
disks large-associated protein 5 isoform b
NCBI Official Synonym Full Names
DLG associated protein 5
NCBI Official Symbol
DLGAP5
NCBI Official Synonym Symbols
DLG7; HURP
NCBI Protein Information
disks large-associated protein 5
UniProt Protein Name
Disks large-associated protein 5
UniProt Gene Name
DLGAP5
UniProt Synonym Gene Names
DLG7; KIAA0008; DAP-5; HURP

Uniprot Description

Potential cell cycle regulator that may play a role in carcinogenesis of cancer cells. Mitotic phosphoprotein regulated by the ubiquitin-proteasome pathway. Key regulator of adherens junction integrity and differentiation that may be involved in CDH1-mediated adhesion and signaling in epithelial cells.

Research Articles on DLGAP5

Similar Products

Product Notes

The DLGAP5 dlgap5 (Catalog #AAA9133610) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DLGAP5 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's DLGAP5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). WB: 1:500 - 1:2000 IF: 1:50 - 1:200. Researchers should empirically determine the suitability of the DLGAP5 dlgap5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: KNVFRKKVVS GIASKPKQDD AGRIAARNRL AAIKNAMRER IRQEECAETA VSVIPKEVDK IVFDAGFFRV ESPVKLFSGL SVSSEGPSQR LGTPKSVNKA VSQSRNEMGI PQQTTSPENA GPQNTKSEHV KKTLFLSIPE SRSSIEDAQC PGLPDLIEEN HVVNKTDLKV DCLSSERMSL PLLAGGVADD INTNKKEGIS DVVEGMELNS SITSQDVLMS SPEKNTASQN SILEEGETKI SQSELFDNKS LTTEC. It is sometimes possible for the material contained within the vial of "DLGAP5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.