Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DIRC2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)

Rabbit DIRC2 Polyclonal Antibody | anti-DIRC2 antibody

DIRC2 antibody - middle region

Gene Names
SLC49A4; RCC4; DIRC2
Reactivity
Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DIRC2; Polyclonal Antibody; DIRC2 antibody - middle region; anti-DIRC2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AAESSRAHIKDRIEAVLYAEFGVVCLIFSATLAYFPPRPPLPPSVAAASQ
Sequence Length
478
Applicable Applications for anti-DIRC2 antibody
Western Blot (WB)
Homology
Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DIRC2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DIRC2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)

Western Blot (WB) (WB Suggested Anti-DIRC2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)
Related Product Information for anti-DIRC2 antibody
This is a rabbit polyclonal antibody against DIRC2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DIRC2 is a membrane-bound protein from the major facilitator superfamily of transporters. Disruption of DIRC2 by translocation has been associated with haplo-insufficiency and renal cell carcinomas. Alternatively spliced transcript variants have been described, but their biological validity has not yet been determined.This gene encodes a membrane-bound protein from the major facilitator superfamily of transporters. Disruption of this gene by translocation has been associated with haplo-insufficiency and renal cell carcinomas. Alternatively spliced transcript variants have been described, but their biological validity has not yet been determined. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence and transcripts to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments.
Product Categories/Family for anti-DIRC2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
solute carrier family 49 member 4
NCBI Official Synonym Full Names
solute carrier family 49 member 4
NCBI Official Symbol
SLC49A4
NCBI Official Synonym Symbols
RCC4; DIRC2
NCBI Protein Information
solute carrier family 49 member 4
UniProt Protein Name
Disrupted in renal carcinoma protein 2
UniProt Gene Name
DIRC2
UniProt Entry Name
DIRC2_HUMAN

NCBI Description

This gene encodes a membrane-bound protein from the major facilitator superfamily of transporters. Disruption of this gene by translocation has been associated with haplo-insufficiency and renal cell carcinomas. Alternatively spliced transcript variants have been described, but their biological validity has not yet been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

DIRC2: Electrogenic metabolite transporter. A chromosomal aberration involving DIRC2 has been found in a family with renal carcinoma. Translocation t(2;3)(q35;q21). Belongs to the major facilitator superfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 3q21.1

Cellular Component: lysosomal membrane; integral to membrane

Biological Process: transport

Disease: Renal Cell Carcinoma, Nonpapillary

Research Articles on DIRC2

Similar Products

Product Notes

The DIRC2 dirc2 (Catalog #AAA3209805) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DIRC2 antibody - middle region reacts with Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DIRC2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DIRC2 dirc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AAESSRAHIK DRIEAVLYAE FGVVCLIFSA TLAYFPPRPP LPPSVAAASQ. It is sometimes possible for the material contained within the vial of "DIRC2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.