Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-DHX57 Polyclonal Antibody)

Rabbit anti-Human, Rat DHX57 Polyclonal Antibody | anti-DHX57 antibody

DHX57 Polyclonal Antibody

Gene Names
DHX57; DDX57
Reactivity
Human, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
DHX57; Polyclonal Antibody; DHX57 Polyclonal Antibody; DDX57; DExH-box helicase 57; anti-DHX57 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
3.28 mg/ml (varies by lot)
Sequence Length
1386
Applicable Applications for anti-DHX57 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 700-900 of human DHX57 (NP_945314.1).
Immunogen Sequence
SATLNAELFSDYFNSCPVITIPGRTFPVDQFFLEDAIAVTRYVLQDGSPYMRSMKQISKEKLKARRNRTAFEEVEEDLRLSLHLQDQDSVKDAVPDQQLDFKQLLARYKGVSKSVIKTMSIMDFEKVNLELIEALLEWIVDGKHSYPPGAILVFLPGLAEIKMLYEQLQSNSLFNNRRSNRCVIHPLHSSLSSEEQQAVFV
Positive Samples
U-87MG, Rat Eye
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-DHX57 Polyclonal Antibody)

Western Blot (WB) (Western blot-DHX57 Polyclonal Antibody)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 49kDa; 73kDa; 155kDa
Observed: 150-155kDa
NCBI Official Full Name
putative ATP-dependent RNA helicase DHX57 isoform 1
NCBI Official Synonym Full Names
DExH-box helicase 57
NCBI Official Symbol
DHX57
NCBI Official Synonym Symbols
DDX57
NCBI Protein Information
putative ATP-dependent RNA helicase DHX57
UniProt Protein Name
Putative ATP-dependent RNA helicase DHX57
UniProt Gene Name
DHX57

Uniprot Description

Probable ATP-binding RNA helicase.

Similar Products

Product Notes

The DHX57 dhx57 (Catalog #AAA9140932) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DHX57 Polyclonal Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DHX57 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the DHX57 dhx57 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DHX57, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.