Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DHRS9 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: THP-1 cell lysate)

Rabbit DHRS9 Polyclonal Antibody | anti-DHRS9 antibody

DHRS9 antibody - middle region

Gene Names
DHRS9; RDHL; RDH15; RDH-E2; RDHTBE; SDR9C4; RDH-TBE; RETSDR8; 3ALPHA-HSD; 3-alpha-HSD
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DHRS9; Polyclonal Antibody; DHRS9 antibody - middle region; anti-DHRS9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPV
Sequence Length
319
Applicable Applications for anti-DHRS9 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DHRS9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DHRS9 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: THP-1 cell lysate)

Western Blot (WB) (WB Suggested Anti-DHRS9 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: THP-1 cell lysate)
Related Product Information for anti-DHRS9 antibody
This is a rabbit polyclonal antibody against DHRS9. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DHRS9 is a 3-alpha-hydroxysteroid dehydrogenase that converts 3-alpha-tetrahydroprogesterone (allopregnanolone) to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone. DHRS9 may play a role in the biosynthesis of retinoic acid from r
Product Categories/Family for anti-DHRS9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
dehydrogenase/reductase SDR family member 9 isoform 1
NCBI Official Synonym Full Names
dehydrogenase/reductase 9
NCBI Official Symbol
DHRS9
NCBI Official Synonym Symbols
RDHL; RDH15; RDH-E2; RDHTBE; SDR9C4; RDH-TBE; RETSDR8; 3ALPHA-HSD; 3-alpha-HSD
NCBI Protein Information
dehydrogenase/reductase SDR family member 9
UniProt Protein Name
Dehydrogenase/reductase SDR family member 9
UniProt Gene Name
DHRS9
UniProt Synonym Gene Names
3-alpha-HSD; RDH-TBE
UniProt Entry Name
DHRS9_HUMAN

NCBI Description

This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. This protein demonstrates oxidoreductase activity toward hydroxysteroids and is able to convert 3-alpha-tetrahydroprogesterone to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone in the cytoplasm, and may additionally function as a transcriptional repressor in the nucleus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]

Uniprot Description

DHRS9: 3-alpha-hydroxysteroid dehydrogenase that converts 3- alpha-tetrahydroprogesterone (allopregnanolone) to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone. May play a role in the biosynthesis of retinoic acid from retinaldehyde, but seems to have low activity with retinoids. Can utilize both NADH and NADPH. Belongs to the short-chain dehydrogenases/reductases (SDR) family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Oxidoreductase; Cofactor and Vitamin Metabolism - retinol; Endoplasmic reticulum; Secreted, signal peptide; EC 1.1.-.-

Chromosomal Location of Human Ortholog: 2q31.1

Cellular Component: endoplasmic reticulum membrane; integral to endoplasmic reticulum membrane

Molecular Function: alcohol dehydrogenase activity; racemase and epimerase activity; 3-alpha(17-beta)-hydroxysteroid dehydrogenase (NAD+) activity; retinol dehydrogenase activity

Biological Process: epithelial cell differentiation; retinol metabolic process; androgen metabolic process; 9-cis-retinoic acid biosynthetic process; progesterone metabolic process

Research Articles on DHRS9

Similar Products

Product Notes

The DHRS9 dhrs9 (Catalog #AAA3211327) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DHRS9 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DHRS9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DHRS9 dhrs9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DPVKVIEKKL AIWEQLSPDI KQQYGEGYIE KSLDKLKGNK SYVNMDLSPV. It is sometimes possible for the material contained within the vial of "DHRS9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.