Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (DHRS4L2 polyclonal antibody. Western Blot analysis of DHRS4L2 expression in human kidney.)

Mouse anti-Human DHRS4L2 Polyclonal Antibody | anti-DHRS4L2 antibody

DHRS4L2 (Dehydrogenase/Reductase SDR Family Member 4-like 2, FLJ11525, MGC905, SDR25C3)

Gene Names
DHRS4L2; SDR25C3
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
DHRS4L2; Polyclonal Antibody; DHRS4L2 (Dehydrogenase/Reductase SDR Family Member 4-like 2; FLJ11525; MGC905; SDR25C3); Anti -DHRS4L2 (Dehydrogenase/Reductase SDR Family Member 4-like 2; anti-DHRS4L2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human DHRS4L2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MARLLGLCAWARKSVRLASSRMTRRDPLTNKVALVTASTDGIGFAIARRLAQDRAHVVVSSRKQQNVDQAVATLQGEGLSVTGTVCHVGKAEDRERLVAMAVKLHGGIDILVSNAAVNPFFGSLMDVTEEVWDKTLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLNNTLAIELAPRNIRVNCLHLDLSRLASAGCSGWTRKKRKA
Applicable Applications for anti-DHRS4L2 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human DHRS4L2, aa1-230 (AAH00663).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(DHRS4L2 polyclonal antibody. Western Blot analysis of DHRS4L2 expression in human kidney.)

Western Blot (WB) (DHRS4L2 polyclonal antibody. Western Blot analysis of DHRS4L2 expression in human kidney.)

Western Blot (WB)

(Western Blot analysis of DHRS4L2 expression in transfected 293T cell line by DHRS4L2 polyclonal antibody. Lane 1: DHRS4L2 transfected lysate (25.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of DHRS4L2 expression in transfected 293T cell line by DHRS4L2 polyclonal antibody. Lane 1: DHRS4L2 transfected lysate (25.3kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-DHRS4L2 antibody
Probable oxidoreductase.
Product Categories/Family for anti-DHRS4L2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24,586 Da
NCBI Official Full Name
dehydrogenase/reductase SDR family member 4-like 2 isoform 4
NCBI Official Synonym Full Names
dehydrogenase/reductase (SDR family) member 4 like 2
NCBI Official Symbol
DHRS4L2
NCBI Official Synonym Symbols
SDR25C3
NCBI Protein Information
dehydrogenase/reductase SDR family member 4-like 2; dehydrogenase/reductase (SDR family) member 4 like 2A3; short chain dehydrogenase/reductase family 25C, member 3; NADP(H)-dependent retinol dehydrogenase/reductase short isoform-like protein
UniProt Protein Name
Dehydrogenase/reductase SDR family member 4-like 2
UniProt Gene Name
DHRS4L2
UniProt Entry Name
DR4L2_HUMAN

NCBI Description

This gene encodes a member of the short chain dehydrogenase reductase family. The encoded protein may be an NADPH dependent retinol oxidoreductase. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Aug 2010]

Uniprot Description

DHRS4L2: Probable oxidoreductase. Belongs to the short-chain dehydrogenases/reductases (SDR) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted; EC 1.1.-.-; Cofactor and Vitamin Metabolism - retinol; Oxidoreductase

Chromosomal Location of Human Ortholog: 14q11.2

Cellular Component: extracellular region

Molecular Function: oxidoreductase activity

Research Articles on DHRS4L2

Similar Products

Product Notes

The DHRS4L2 dhrs4l2 (Catalog #AAA6007896) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The DHRS4L2 (Dehydrogenase/Reductase SDR Family Member 4-like 2, FLJ11525, MGC905, SDR25C3) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DHRS4L2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the DHRS4L2 dhrs4l2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MARLLGLCAW ARKSVRLASS RMTRRDPLTN KVALVTASTD GIGFAIARRL AQDRAHVVVS SRKQQNVDQA VATLQGEGLS VTGTVCHVGK AEDRERLVAM AVKLHGGIDI LVSNAAVNPF FGSLMDVTEE VWDKTLDINV KAPALMTKAV VPEMEKRGGG SVVIVSSIAA FSPSPGFSPY NVSKTALLGL NNTLAIELAP RNIRVNCLHL DLSRLASAGC SGWTRKKRKA. It is sometimes possible for the material contained within the vial of "DHRS4L2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.