Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunoprecipitation (IP) (Immunoprecipitation of DHDDS transfected lysate using DHDDS rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with DHDDS purified mouse polyclonal antibody.)

Rabbit anti-Human DHDDS Polyclonal Antibody | anti-DHDDS antibody

DHDDS (Dehydrodolichyl Diphosphate Synthase, Dedol-PP Synthase, Cis-isoprenyltransferase, CIT, Cis-IPTase, Epididymis Tissue Protein Li 189m, HDS, FLJ13102)

Gene Names
DHDDS; DS; CIT; CPT; HDS; RP59
Reactivity
Human
Applications
Immunoprecipitation
Purity
Serum
Serum
Synonyms
DHDDS; Polyclonal Antibody; DHDDS (Dehydrodolichyl Diphosphate Synthase; Dedol-PP Synthase; Cis-isoprenyltransferase; CIT; Cis-IPTase; Epididymis Tissue Protein Li 189m; HDS; FLJ13102); Anti -DHDDS (Dehydrodolichyl Diphosphate Synthase; anti-DHDDS antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human DHDDS.
Purity/Purification
Serum
Serum
Form/Format
Supplied as a liquid.
Sequence
MSWIKEGELSLWERFCANIIKAGPMPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKRSKSEVDGLMDLARQKFSRLMEEKCFLNVCFAYTSRHEISNAVREMAWGVEQGLLDPSDISESLLDKCLYTNRSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQPVLWPEYTFWNLFEAILQFQMNHSVLQKARDMYAEERKRQQLERDQATVTEQLLREGLQASGDAQLRRTRLHKLSARREERVQGFLQALELKRADWLARLGTASA
Applicable Applications for anti-DHDDS antibody
Immunoprecipitation (IP)
Application Notes
Suitable for use in Immunoprecipitation.
Immunogen
Full length human DHDDS, aa1-294 (AAH04117.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunoprecipitation (IP)

(Immunoprecipitation of DHDDS transfected lysate using DHDDS rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with DHDDS purified mouse polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of DHDDS transfected lysate using DHDDS rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with DHDDS purified mouse polyclonal antibody.)
Related Product Information for anti-DHDDS antibody
Catalyzes cis-prenyl chain elongation to produce the polyprenyl backbone of dolichol, a glycosyl carrier-lipid required for the biosynthesis of several classes of glycoprotein.
Product Categories/Family for anti-DHDDS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
38,657 Da
NCBI Official Full Name
dehydrodolichyl diphosphate synthase isoform 4
NCBI Official Synonym Full Names
dehydrodolichyl diphosphate synthase
NCBI Official Symbol
DHDDS
NCBI Official Synonym Symbols
DS; CIT; CPT; HDS; RP59
NCBI Protein Information
dehydrodolichyl diphosphate synthase; cis-IPTase; dedol-PP synthase; cis-prenyl transferase; cis-isoprenyltransferase; epididymis tissue protein Li 189m
UniProt Protein Name
Dehydrodolichyl diphosphate synthase
UniProt Gene Name
DHDDS
UniProt Synonym Gene Names
HDS; Dedol-PP synthase; CIT; Cis-IPTase
UniProt Entry Name
DHDDS_HUMAN

NCBI Description

The protein encoded by this gene catalyzes cis-prenyl chain elongation to produce the polyprenyl backbone of dolichol, a glycosyl carrier lipid required for the biosynthesis of several classes of glycoproteins. Mutations in this gene are associated with retinitis pigmentosa type 59. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Aug 2011]

Uniprot Description

Function: Catalyzes cis-prenyl chain elongation to produce the polyprenyl backbone of dolichol, a glycosyl carrier-lipid required for the biosynthesis of several classes of glycoprotein. Ref.7

Pathway: Protein modification; protein glycosylation.

Subunit structure: Interacts with NUS1/NgBR, the interaction is required for efficient activity. Interacts with NPC2. Ref.8

Subcellular location: Endoplasmic reticulum membrane; Peripheral membrane protein. Note: colocalizes with calnexin. Ref.7

Tissue specificity: Expressed at high levels in testis and kidney. Expressed in epididymis (at protein level). Slightly expressed in heart, spleen and thymus. Ref.2

Involvement in disease: Retinitis pigmentosa 59 (RP59) [MIM:613861]: A retinal dystrophy belonging to the group of pigmentary retinopathies. Retinitis pigmentosa is characterized by retinal pigment deposits visible on fundus examination and primary loss of rod photoreceptor cells followed by secondary loss of cone photoreceptors. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.9

Sequence similarities: Belongs to the UPP synthase family.

Research Articles on DHDDS

Similar Products

Product Notes

The DHDDS dhdds (Catalog #AAA647615) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DHDDS (Dehydrodolichyl Diphosphate Synthase, Dedol-PP Synthase, Cis-isoprenyltransferase, CIT, Cis-IPTase, Epididymis Tissue Protein Li 189m, HDS, FLJ13102) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DHDDS can be used in a range of immunoassay formats including, but not limited to, Immunoprecipitation (IP). Suitable for use in Immunoprecipitation. Researchers should empirically determine the suitability of the DHDDS dhdds for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSWIKEGELS LWERFCANII KAGPMPKHIA FIMDGNRRYA KKCQVERQEG HSQGFNKLAE TLRWCLNLGI LEVTVYAFSI ENFKRSKSEV DGLMDLARQK FSRLMEEKCF LNVCFAYTSR HEISNAVREM AWGVEQGLLD PSDISESLLD KCLYTNRSPH PDILIRTSGE VRLSDFLLWQ TSHSCLVFQP VLWPEYTFWN LFEAILQFQM NHSVLQKARD MYAEERKRQQ LERDQATVTE QLLREGLQAS GDAQLRRTRL HKLSARREER VQGFLQALEL KRADWLARLG TASA. It is sometimes possible for the material contained within the vial of "DHDDS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.