Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: DGCR6Sample Tissue: Human Hela Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human DGCR6 Polyclonal Antibody | anti-DGCR6 antibody

DGCR6 Antibody - middle region

Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
DGCR6; Polyclonal Antibody; DGCR6 Antibody - middle region; anti-DGCR6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVLQAAQQ
Sequence Length
220
Applicable Applications for anti-DGCR6 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DGCR6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: DGCR6Sample Tissue: Human Hela Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: DGCR6Sample Tissue: Human Hela Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-DGCR6 antibody
DiGeorge syndrome, and more widely, the CATCH 22 syndrome, are associated with microdeletions in chromosomal region 22q11.2. The product of this gene shares homology with the Drosophila melanogaster gonadal protein, which participates in gonadal and germ cell development, and with the gamma-1 subunit of human laminin. This gene is a candidate for involvement in DiGeorge syndrome pathology and in schizophrenia.
Product Categories/Family for anti-DGCR6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25 kDa
NCBI Official Full Name
protein DGCR6
NCBI Official Synonym Full Names
DiGeorge syndrome critical region gene 6
NCBI Official Symbol
DGCR6
NCBI Protein Information
protein DGCR6
UniProt Protein Name
Protein DGCR6
Protein Family
UniProt Gene Name
DGCR6
UniProt Entry Name
DGCR6_HUMAN

NCBI Description

DiGeorge syndrome, and more widely, the CATCH 22 syndrome, are associated with microdeletions in chromosomal region 22q11.2. The product of this gene shares homology with the Drosophila melanogaster gonadal protein, which participates in gonadal and germ cell development, and with the gamma-1 subunit of human laminin. This gene is a candidate for involvement in DiGeorge syndrome pathology and in schizophrenia. [provided by RefSeq, Nov 2008]

Uniprot Description

DGCR6: May play a role in neural crest cell migration into the third and fourth pharyngeal pouches. Belongs to the gonadal family.

Protein type: Cell adhesion; Extracellular matrix; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 22q11.21|22q11

Cellular Component: proteinaceous extracellular matrix; nucleus

Biological Process: organ morphogenesis; cell adhesion

Disease: Velocardiofacial Syndrome

Research Articles on DGCR6

Similar Products

Product Notes

The DGCR6 dgcr6 (Catalog #AAA3220451) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DGCR6 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DGCR6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DGCR6 dgcr6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QHLTEKSLYN QRLRLQNEHR VLRQALRQKH QEAQQACRPH NLPVLQAAQQ. It is sometimes possible for the material contained within the vial of "DGCR6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.