Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: DECR1Sample Tissue: Human PANC1 Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human DECR1 Polyclonal Antibody | anti-DECR1 antibody

DECR1 Antibody - C-terminal region

Gene Names
DECR1; DECR; NADPH; SDR18C1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
DECR1; Polyclonal Antibody; DECR1 Antibody - C-terminal region; anti-DECR1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ELANLAAFLCSDYASWINGAVIKFDGGEEVLISGEFNDLRKVTKEQWDTI
Sequence Length
167
Applicable Applications for anti-DECR1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human DECR1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: DECR1Sample Tissue: Human PANC1 Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: DECR1Sample Tissue: Human PANC1 Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-DECR1 antibody
This gene encodes an accessory enzyme which participates in the beta-oxidation and metabolism of unsaturated fatty enoyl-CoA esters.
Product Categories/Family for anti-DECR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36 kDa
NCBI Official Full Name
2,4-dienoyl-CoA reductase, mitochondrial isoform 1
NCBI Official Synonym Full Names
2,4-dienoyl-CoA reductase 1
NCBI Official Symbol
DECR1
NCBI Official Synonym Symbols
DECR; NADPH; SDR18C1
NCBI Protein Information
2,4-dienoyl-CoA reductase, mitochondrial
UniProt Protein Name
2,4-dienoyl-CoA reductase, mitochondrial
Protein Family
UniProt Gene Name
DECR1
UniProt Synonym Gene Names
DECR; SDR18C1; 4-enoyl-CoA reductase [NADPH]
UniProt Entry Name
DECR_HUMAN

NCBI Description

This gene encodes an accessory enzyme which participates in the beta-oxidation and metabolism of unsaturated fatty enoyl-CoA esters. [provided by RefSeq, Jul 2008]

Uniprot Description

DECR1: Auxiliary enzyme of beta-oxidation. It participates in the metabolism of unsaturated fatty enoyl-CoA esters having double bonds in both even- and odd-numbered positions. Catalyzes the NADP-dependent reduction of 2,4-dienoyl-CoA to yield trans-3- enoyl-CoA. Belongs to the short-chain dehydrogenases/reductases (SDR) family. 2,4-dienoyl-CoA reductase subfamily.

Protein type: Oxidoreductase; Mitochondrial; EC 1.3.1.34

Chromosomal Location of Human Ortholog: 8q21.3

Cellular Component: nucleoplasm; mitochondrion; mitochondrial matrix; cytoplasm; nucleus

Molecular Function: oxidoreductase activity, acting on NADH or NADPH; 2,4-dienoyl-CoA reductase (NADPH) activity

Biological Process: fatty acid beta-oxidation; cellular lipid metabolic process; protein homotetramerization

Research Articles on DECR1

Similar Products

Product Notes

The DECR1 decr1 (Catalog #AAA3220228) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DECR1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DECR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DECR1 decr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ELANLAAFLC SDYASWINGA VIKFDGGEEV LISGEFNDLR KVTKEQWDTI. It is sometimes possible for the material contained within the vial of "DECR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.