Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: DDX6Sample Tissue: Human HelaAntibody Dilution: 1.0ug/ml)

Rabbit DDX6 Polyclonal Antibody | anti-DDX6 antibody

DDX6 antibody - N-terminal region

Gene Names
DDX6; P54; RCK; HLR2
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DDX6; Polyclonal Antibody; DDX6 antibody - N-terminal region; anti-DDX6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYL
Sequence Length
472
Applicable Applications for anti-DDX6 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human DDX6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: DDX6Sample Tissue: Human HelaAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: DDX6Sample Tissue: Human HelaAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-DDX6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: OVCAR-3 cell lysateDDX6 is supported by BioGPS gene expression data to be expressed in OVCAR3)

Western Blot (WB) (WB Suggested Anti-DDX6 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: OVCAR-3 cell lysateDDX6 is supported by BioGPS gene expression data to be expressed in OVCAR3)
Related Product Information for anti-DDX6 antibody
This is a rabbit polyclonal antibody against DDX6. It was validated on Western Blot

Target Description: This gene encodes a member of the DEAD box protein family. The protein is an RNA helicase found in P-bodies and stress granules, and functions in translation suppression and mRNA degradation. It is required for microRNA-induced gene silencing.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
probable ATP-dependent RNA helicase DDX6
NCBI Official Synonym Full Names
DEAD-box helicase 6
NCBI Official Symbol
DDX6
NCBI Official Synonym Symbols
P54; RCK; HLR2
NCBI Protein Information
probable ATP-dependent RNA helicase DDX6
UniProt Protein Name
Probable ATP-dependent RNA helicase DDX6
UniProt Gene Name
DDX6
UniProt Synonym Gene Names
HLR2; RCK
UniProt Entry Name
DDX6_HUMAN

NCBI Description

This gene encodes a member of the DEAD box protein family. The protein is an RNA helicase found in P-bodies and stress granules, and functions in translation suppression and mRNA degradation. It is required for microRNA-induced gene silencing. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Mar 2012]

Uniprot Description

DDX6: an oncogenic ATP-dependent helicase of the DEAD box family. Interacts with argonaute proteins, Ago1 and Ago2, and is a general repressor of translation in human cells by miRNA-induced gene silencing. In the process of mRNA degradation, may play a role in mRNA decapping.

Protein type: RNA processing; Oncoprotein; EC 3.6.4.13; Helicase; RNA-binding

Chromosomal Location of Human Ortholog: 11q23.3

Cellular Component: intracellular membrane-bound organelle; membrane; stress granule; cytoplasm; cytosol

Molecular Function: protein domain specific binding; protein binding; helicase activity; ATP binding; RNA helicase activity

Biological Process: gene expression; cytoplasmic mRNA processing body assembly; mRNA catabolic process, deadenylation-dependent decay

Research Articles on DDX6

Similar Products

Product Notes

The DDX6 ddx6 (Catalog #AAA3203098) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DDX6 antibody - N-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's DDX6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DDX6 ddx6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CLKRELLMGI FEMGWEKPSP IQEESIPIAL SGRDILARAK NGTGKSGAYL. It is sometimes possible for the material contained within the vial of "DDX6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.