Western Blot (WB)
(WB Suggested Anti-DDX58 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: OVCAR-3 cell lysate)
Rabbit anti-Horse, Human DDX58 Polyclonal Antibody | anti-DDX58 antibody
DDX58 antibody - middle region
Gene Names
DDX58; RIG1; RIGI; RIG-I; RLR-1; SGMRT2
Reactivity
Horse, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DDX58; Polyclonal Antibody; DDX58 antibody - middle region; anti-DDX58 antibody
Host
Rabbit
Reactivity
Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIH
Sequence Length
925
Applicable Applications for anti-DDX58 antibody
Western Blot (WB)
Homology
Horse: 79%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DDX58
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-DDX58 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: OVCAR-3 cell lysate)
Western Blot (WB)
(WB Suggested Anti-DDX58 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: OVCAR-3 cell lysate)
Related Product Information for anti-DDX58 antibody
This is a rabbit polyclonal antibody against DDX58. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases which are implicated in a number of cellular processes involving RNA binding and alteration of RNA secondary structure. This gene encodes a protein
Target Description: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases which are implicated in a number of cellular processes involving RNA binding and alteration of RNA secondary structure. This gene encodes a protein
Product Categories/Family for anti-DDX58 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
106kDa
NCBI Official Full Name
probable ATP-dependent RNA helicase DDX58
NCBI Official Synonym Full Names
DExD/H-box helicase 58
NCBI Official Symbol
DDX58
NCBI Official Synonym Symbols
RIG1; RIGI; RIG-I; RLR-1; SGMRT2
NCBI Protein Information
probable ATP-dependent RNA helicase DDX58
UniProt Protein Name
Probable ATP-dependent RNA helicase DDX58
Protein Family
UniProt Gene Name
DDX58
UniProt Synonym Gene Names
RLR-1; RIG-1; RIG-I
UniProt Entry Name
DDX58_HUMAN
NCBI Description
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases which are implicated in a number of cellular processes involving RNA binding and alteration of RNA secondary structure. This gene encodes a protein containing RNA helicase-DEAD box protein motifs and a caspase recruitment domain (CARD). It is involved in viral double-stranded (ds) RNA recognition and the regulation of immune response. [provided by RefSeq, Jul 2008]
Research Articles on DDX58
Similar Products
Product Notes
The DDX58 ddx58 (Catalog #AAA3203127) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DDX58 antibody - middle region reacts with Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's DDX58 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DDX58 ddx58 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EECHYTVLGD AFKECFVSRP HPKPKQFSSF EKRAKIFCAR QNCSHDWGIH. It is sometimes possible for the material contained within the vial of "DDX58, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
