Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DDX50 Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateDDX50 is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit DDX50 Polyclonal Antibody | anti-DDX50 antibody

DDX50 antibody - N-terminal region

Gene Names
DDX50; GU2; GUB; mcdrh; RH-II/GuB
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit
Applications
Western Blot
Purity
Protein A purified
Synonyms
DDX50; Polyclonal Antibody; DDX50 antibody - N-terminal region; anti-DDX50 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EESESQKKERQKSDRRKSRHHYDSDEKSETRENGVTDDLDAPKAKKSKMK
Sequence Length
737
Applicable Applications for anti-DDX50 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Pig: 93%; Rabbit: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human DDX50
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DDX50 Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateDDX50 is supported by BioGPS gene expression data to be expressed in Jurkat)

Western Blot (WB) (WB Suggested Anti-DDX50 Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateDDX50 is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-DDX50 antibody
This is a rabbit polyclonal antibody against DDX50. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX50 is a DEAD box enzyme that may be involved in ribosomal RNA synthesis or processing. DDX50 and DDX21, also called RH-II/GuA, have similar genomic structures and are in tandem orientation on chromosome 10, suggesting that the two genes arose by gene duplication in evolution. DDX50 gene has pseudogenes on chromosomes 2, 3 and 4. Alternative splicing of this gene generates multiple transcript variants, but the full length nature of all the other variants but one has not been defined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
81kDa
NCBI Official Full Name
ATP-dependent RNA helicase DDX50
NCBI Official Synonym Full Names
DExD-box helicase 50
NCBI Official Symbol
DDX50
NCBI Official Synonym Symbols
GU2; GUB; mcdrh; RH-II/GuB
NCBI Protein Information
ATP-dependent RNA helicase DDX50
UniProt Protein Name
ATP-dependent RNA helicase DDX50
UniProt Gene Name
DDX50
UniProt Entry Name
DDX50_HUMAN

NCBI Description

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box enzyme that may be involved in ribosomal RNA synthesis or processing. This gene and DDX21, also called RH-II/GuA, have similar genomic structures and are in tandem orientation on chromosome 10, suggesting that the two genes arose by gene duplication in evolution. This gene has pseudogenes on chromosomes 2, 3 and 4. Alternative splicing of this gene generates multiple transcript variants, but the full length nature of all the other variants but one has not been defined. [provided by RefSeq, Jul 2008]

Uniprot Description

DDX50: an RNA helicase of the DEAD-box family.

Protein type: EC 3.6.4.13; RNA-binding; Helicase; Nucleolus

Chromosomal Location of Human Ortholog: 10q22.1

Cellular Component: membrane; nucleolus; plasma membrane

Molecular Function: helicase activity; ATP binding

Biological Process: metabolic process

Research Articles on DDX50

Similar Products

Product Notes

The DDX50 ddx50 (Catalog #AAA3203163) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DDX50 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's DDX50 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DDX50 ddx50 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EESESQKKER QKSDRRKSRH HYDSDEKSET RENGVTDDLD APKAKKSKMK. It is sometimes possible for the material contained within the vial of "DDX50, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.