Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DDX5 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysateDDX5 is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit DDX5 Polyclonal Antibody | anti-DDX5 antibody

DDX5 antibody - C-terminal region

Gene Names
DDX5; p68; HLR1; G17P1; HUMP68
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
DDX5; Polyclonal Antibody; DDX5 antibody - C-terminal region; anti-DDX5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAY
Sequence Length
614
Applicable Applications for anti-DDX5 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human DDX5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DDX5 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysateDDX5 is supported by BioGPS gene expression data to be expressed in Jurkat)

Western Blot (WB) (WB Suggested Anti-DDX5 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysateDDX5 is supported by BioGPS gene expression data to be expressed in Jurkat)
Related Product Information for anti-DDX5 antibody
This is a rabbit polyclonal antibody against DDX5. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX5 encodes a DEAD box protein, which is a RNA-dependent ATPase, and also a proliferation-associated nuclear antigen, specifically reacting with the simian virus 40 tumor antigen. DDX5 consists of 13 exons, and alternatively spliced transcripts containing several intron sequences have been detected, but no isoforms encoded by these transcripts have been identified.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68kDa
NCBI Official Full Name
probable ATP-dependent RNA helicase DDX5 isoform a
NCBI Official Synonym Full Names
DEAD-box helicase 5
NCBI Official Symbol
DDX5
NCBI Official Synonym Symbols
p68; HLR1; G17P1; HUMP68
NCBI Protein Information
probable ATP-dependent RNA helicase DDX5
UniProt Protein Name
Probable ATP-dependent RNA helicase DDX5
UniProt Gene Name
DDX5
UniProt Synonym Gene Names
G17P1; HELR; HLR1
UniProt Entry Name
DDX5_HUMAN

NCBI Description

This gene encodes a member of the DEAD box family of RNA helicases that are involved in a variety of cellular processes as a result of its role as an adaptor molecule, promoting interactions with a large number of other factors. This protein is involved in pathways that include the alteration of RNA structures, plays a role as a coregulator of transcription, a regulator of splicing, and in the processing of small noncoding RNAs. Members of this family contain nine conserved motifs, including the conserved Asp-Glu-Ala-Asp (DEAD) motif, important to ATP binding and hydrolysis as well as RNA binding and unwinding activities. Dysregulation of this gene may play a role in cancer development. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2017]

Uniprot Description

DDX5: a putative ATP-dependent RNA helicase. A proliferation-associated nuclear antigen, specifically reacting with the simian virus 40 tumor antigen. The rate of ATP hydrolysis is highly stimulated by single-stranded RNA. Belongs to the DEAD box helicase family. DDX5/DDX17 subfamily. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly.

Protein type: RNA splicing; Spliceosome; Nuclear receptor co-regulator; Helicase; EC 3.6.4.13; RNA-binding; Nucleolus

Chromosomal Location of Human Ortholog: 17q21

Cellular Component: nucleoplasm; membrane; nucleolus; ribonucleoprotein complex; nucleus

Molecular Function: calmodulin binding; protein binding; enzyme binding; androgen receptor binding; transcription coactivator activity; estrogen receptor binding; calcium-dependent protein binding; RNA helicase activity; ATP-dependent RNA helicase activity; ATP binding

Biological Process: circadian rhythm; nuclear mRNA splicing, via spliceosome; transcription, DNA-dependent; regulation of osteoblast differentiation; in utero embryonic development; positive regulation of estrogen receptor signaling pathway; positive regulation of transcription from RNA polymerase II promoter; positive regulation of DNA damage response, signal transduction by p53 class mediator; negative regulation of transcription from RNA polymerase II promoter; cell growth; regulation of viral genome replication; regulation of alternative nuclear mRNA splicing, via spliceosome

Research Articles on DDX5

Similar Products

Product Notes

The DDX5 ddx5 (Catalog #AAA3203096) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DDX5 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DDX5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DDX5 ddx5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SFGSNFVSAG IQTSFRTGNP TGTYQNGYDS TQQYGSNVPN MHNGMNQQAY. It is sometimes possible for the material contained within the vial of "DDX5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.