Highly validated and characterized monoclonal/polyclonal
antibodies and recombinant
proteins
The majority of AAA Biotech’s antibodies are highly validated and can be use in multiple
applications such as ELISA, FC,
ICC, IF, IHC, IP, WB, etc. We have antibodies available for rare species, in multiple conjugated
forms or recombinant
antibodies.
As for our high quality proteins, the majority have 90% purity, detected by SDS-PAGE while some are
available in
different tags such as Flag, GST, His, MBP, etc. We also carry high quality native and biologically
active proteins.
AAA Biotech is constantly working to expand our capacity to provide recombinant proteins and
antibodies to most
target proteins.
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '24174'
Query
Database
1.38 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '28265'
Query
Database
1.32 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '24707'
Query
Database
1.25 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '24974'
Query
Database
1.47 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '26515'
Query
Database
1.29 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '25270'
Query
Database
1.32 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '28359'
Query
Database
1.29 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '24514'
Query
Database
3.47 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '26562'
Query
Database
2.30 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '26582'
Query
Database
1.56 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '28118'
Query
Database
1.37 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '28370'
Query
Database
2.65 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '24784'
Query
Database
4.77 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '28325'
Query
Database
1.48 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '28350'
Query
Database
1.35 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '24270'
Query
Database
1.33 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '28129'
Query
Database
1.50 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '10713'
Query
Database
1.55 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '26371'
Query
Database
1.92 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '10761'
Query
Database
1.71 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '30735'
Query
Database
1.63 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '26636'
Query
Database
2.44 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '25370'
Query
Database
2.83 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '10779'
Query
Database
1.69 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '11803'
Query
Database
2.10 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '26144'
Query
Database
1.68 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '26410'
Query
Database
1.42 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '28202'
Query
Database
1.25 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '28215'
Query
Database
1.29 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '26419'
Query
Database
1.67 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '24376'
Query
Database
1.51 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '25407'
Query
Database
1.25 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '25674'
Query
Database
1.45 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '28225'
Query
Database
1.33 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '28248'
Query
Database
3.04 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '26459'
Query
Database
1.31 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '24928'
Query
Database
3.12 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '11632'
Query
Database
1.49 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '25972'
Query
Database
1.30 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '24961'
Query
Database
1.49 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '24968'
Query
Database
2.12 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '24225'
Query
Database
1.71 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '24493'
Query
Database
2.44 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '25013'
Query
Database
1.81 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '25264'
Query
Database
1.45 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '28080'
Query
Database
1.67 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '26546'
Query
Database
1.31 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '25783'
Query
Database
1.31 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '25532'
Query
Database
1.66 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '28097'
View: search.php
Views
103.85 ms
View: template.php
Views
99.88 ms
After Filters
Timer
0.12 ms
Database (50 total Queries, 50 of them unique across 2 Connections)
Time
Query String
1.36 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '24174'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '28265'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '24707'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '24974'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '26515'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '25270'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '28359'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '24514'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '26562'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '26582'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '28118'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '28370'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '24784'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '28325'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '28350'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '24270'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '28129'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '10713'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '26371'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '10761'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '30735'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '26636'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '25370'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '10779'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '11803'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '26144'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '26410'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '28202'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '28215'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '26419'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '24376'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '25407'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '25674'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '28225'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '28248'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '26459'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '24928'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '11632'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '25972'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '24961'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '24968'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '24225'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '24493'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '25013'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '25264'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '28080'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '26546'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '25783'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '25532'
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '28097'
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (30) "ELISA (EIA), Western Blot (WB)"
⇄⧉etc_term1 => string (271) "Immunogen||Partial recombinant corresponding to aa585-685, from human CPSF3 ...
$value['hits']['hits'][0]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa585-685, from human CPSF3 (NP_057291) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||LEVQSNPKIRKGAVQKVSKKLEMHVYSKRLEIMLQDIFGEDCVSVKDDSILSVTVDGKTANLNLETRTVECEEGSEDDESLREMVELAAQRLYEALTPVH!!Conjugate||AP
Cleavage Of Growing Transcript In The Termination Region Pathway||106560!!Gene Expression Pathway||105937!!Processing Of Capped Intron-Containing Pre-mRNA Pathway||160950!!Processing Of Capped Intronless Pre-mRNA Pathway||160951!!Processing Of Intronless Pre-mRNAs Pathway||160954!!RNA Polymerase II Transcription Pathway||106557!!RNA Polymerase II Transcription Termination Pathway||106559!!Transport Of Mature Transcript To Cytoplasm Pathway||105959!!Transport Of Mature MRNA Derived From An Intronless Transcript Pathway||105964!!Transport Of Mature MRNAs Derived From Intronless Transcripts Pathway||105961
aaa24174 mouse human rat monoclonal igg2a,k 6e6 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with alkaline phosphatase ap recognizes cpsf3 species crossreactivity and elisa eia western blot wb applications are based on unconjugated antibody detection against immunogen 37.11kd mbs6114330_wb analysis of expression pc 12 mbs6114330_wb2 hela ne mbs6114330_wb3 immunofluorescence if to cell concentration 10ug ml mbs6114330_if4 testing data limit for recombinant gst tagged is ~0.1ng capture mbs6114330_td5 transfected 293t line lane 1 lysate 77.5kd 2 non mbs6114330_wb6 nih 3t3 mbs6114330_wb7 cleavage polyadenylation specificity factor subunit 3 73kd cpsf mrna 3' end processing endonuclease 73 cpsf73 specific 73kda 77,486 da kda cpsf3_human 7706427 np_057291 q9ukf6 nm_016207 q53rs2 o14769 q96f36 606029 antibodies proteins partial corresponding aa585 685 from tag mw the alone 26kd sequence levqsnpkirkgavqkvskklemhvyskrleimlqdifgedcvsvkddsilsvtvdgktanlnletrtveceegseddeslremvelaaqrlyealtpvh conjugate igg2a,k6e6 ph7.2 pc12 lane1 77.5kd2 subunit3 endonuclease73 aa585685
IP (Immunoprecipitation)||Immunoprecipitation analysis of 200ug extracts of Jurkat cells using 1ug EIF3H antibody. Western blot was performed from the immunoprecipitate using EIF3H antibody at a dilition of 1:1000.||AAA28265_IP6.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded mouse heart using EIF3H Antibody at dilution of 1:100 (40x lens).||AAA28265_IHC5.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded mouse brain using EIF3H Antibody at dilution of 1:100 (40x lens).||AAA28265_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human prostate using EIF3H Antibody at dilution of 1:100 (40x lens).||AAA28265_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded rat brain using EIF3H Antibody at dilution of 1:100 (40x lens).||AAA28265_IHC2.jpg!!WB (Western Blot)||Western blot analysis of extracts of various cell lines, using EIF3H antibody at 1:1000 dilution.<br>Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.<br>Lysates/proteins: 25ug per lane.<br>Blocking buffer: 3% nonfat dry milk in TBST.<br>Detection: ECL Basic Kit.<br>Exposure time: 1s.||AAA28265_WB.jpg
⇄etc_term1 => string (71) "Immunogen||Recombinant protein of human EIF3H!!Immunogen Species||Human"
Activation Of The MRNA Upon Binding Of The Cap-binding Complex And EIFs, And Subsequent Binding To 43S Pathway||105970!!Cap-dependent Translation Initiation Pathway||105967!!Eukaryotic Translation Initiation Pathway||105966!!Formation Of A Pool Of Free 40S Subunits Pathway||105968!!Formation Of The Ternary Complex, And Subsequently, The 43S Complex Pathway||105969!!GTP Hydrolysis And Joining Of The 60S Ribosomal Subunit Pathway||105973!!Gene Expression Pathway||105937!!L13a-mediated Translational Silencing Of Ceruloplasmin Expression Pathway||160955!!Measles Pathway||213306!!Measles Pathway||213277
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
WB (Western Blot)||ACBD3 monoclonal antibody. Western Blot analysis of ACBD3 expression in PC-12.||AAA24707_WB7.jpg!!WB (Western Blot)||ACBD3 monoclonal antibody, Western Blot analysis of ACBD3 expression in HeLa.||AAA24707_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged ACBD3 is ~0.1ng/ml as a capture antibody.||AAA24707_APP5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to ACBD3 on HeLa cell. [antibody concentration 10ug/ml].||AAA24707_IF4.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to ACBD3 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3ug/ml].||AAA24707_IHC3.jpg!!WB (Western Blot)||Western Blot analysis of ACBD3 expression in transfected 293T cell line by ACBD3 monoclonal antibody. Lane 1: ACBD3 transfected lysate (60.6kD). Lane 2: Non-transfected lysate.||AAA24707_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (37kD).||AAA24707_WB.jpg
⇄⧉etc_term1 => string (272) "Immunogen||Partial recombinant corresponding to aa73-172 from human ACBD3 (N...
$value['hits']['hits'][2]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa73-172 from human ACBD3 (NP_073572) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||RRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMGPYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVEFVKLLNRCCHL!!Conjugate||Biotin
ACBD3 (Golgi Resident Protein GCP60, Acyl-CoA-binding Domain-containing Protein 3, Golgi Complex-associated Protein 1, GOCAP1, Golgi Phosphoprotein 1, GOLPH1, PBR- and PKA-associated Protein 7, Peripheral Benzodiazepine Receptor-associated Protein PAP7, G
Acyl-CoA-binding domain-containing protein 3; Golgi complex-associated protein 1; GOCAP1; Golgi phosphoprotein 1; GOLPH1; PBR- and PKA-associated protein 7; Peripheral benzodiazepine receptor-associated protein PAP7
aaa24707 mouse human rat monoclonal igg1,k 2g2 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with biotin recognizes acbd3 species crossreactivity and elisa eia immunofluorescence if immunohistochemistry ihc western blot wb 10ug ml applications are based on unconjugated antibody detection against immunogen 37kd aaa24707_wb analysis of expression transfected 293t cell line lane 1 lysate 60.6kd 2 non aaa24707_wb2 immunoperoxidase to formalin fixed paraffin embedded small intestine concentration 3ug aaa24707_ihc3 hela aaa24707_if4 testing data limit for recombinant gst tagged is ~0.1ng capture aaa24707_td5 aaa24707_wb6 pc 12 aaa24707_wb7 golgi resident gcp60 acyl coa binding domain containing 3 complex associated gocap1 phosphoprotein golph1 pbr pka 7 peripheral benzodiazepine receptor pap7 g 60kda gcp60_human 15826852 np_073572 q9h3p7 nm_022735 606809 antibodies proteins partial corresponding aa73 172 from tag mw the alone 26kd sequence rrleqrwgfgleelyglalrffkekdgkafhptyeeklklvalhkqvlmgpynpdtcpevgffdvlgndrrrewaalgnmskedamvefvkllnrcchl conjugate ph7.2 lane1 60.6kd2 pc12 containing3 pka7 aa73172
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (55) "ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)"
WB (Western Blot)||MAP3K7IP1 monoclonal antibody Western Blot analysis of MAP3K7IP1 expression in PC-12.||AAA24974_WB6.jpg!!Application Data||Proximity Ligation Analysis (PLA) of protein-protein interactions between HSPA1L and MAP3K7IP1 HeLa cells were stained with HSPA1L rabbit purified polyclonal 1:1200 and MAP3K7IP1 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.||AAA24974_APP5.jpg!!Application Data||Detection limit for recombinant GST tagged MAP3K7IP1 is ~0.3ng/ml as a capture antibody.||AAA24974_APP4.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to MAP3K7IP1 on HeLa cell. [antibody concentration 10ug/ml]||AAA24974_IF3.jpg!!WB (Western Blot)||MAP3K7IP1 monoclonal antibody Western Blot analysis of MAP3K7IP1 expression in HeLa.||AAA24974_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (36.89kD).||AAA24974_WB.jpg
⇄⧉etc_term1 => string (268) "Immunogen||Partial recombinant corresponding to aa3-100 from MAP3K7IP1 (NP_7...
$value['hits']['hits'][3]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa3-100 from MAP3K7IP1 (NP_705717) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||AQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNAEHAEA!!Conjugate||Biotin
TAB1 (TGF-beta-activated Kinase 1 and MAP3K7-binding Protein 1, Mitogen-activated Protein Kinase Kinase Kinase 7-interacting Protein 1, TGF-beta-activated Kinase 1-binding Protein 1, TAK1-binding Protein 1, MAP3K7IP1) (Biotin)
aaa24974 mouse human rat monoclonal igg1,k 2a12 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with biotin recognizes map3k7ip1 species crossreactivity elisa eia immunofluorescence if western blot wb 10ug ml applications are based on unconjugated antibody detection against immunogen 36.89kd aaa24974_wb analysis of expression hela aaa24974_wb2 to cell concentration aaa24974_if3 testing data limit for recombinant gst tagged is ~0.3ng capture aaa24974_td4 proximity ligation pla interactions between hspa1l and cells were stained rabbit polyclonal 1:1200 1:50 signals detected 30 kit 613 red nuclei counterstained dapi blue each dot represents the interaction complex aaa24974_td5 pc 12 aaa24974_wb6 tab1 tgf beta activated kinase 1 map3k7 binding mitogen 7 interacting tak1 isoform 3' 50kda 41281798 np_705717 q15750 nm_153497 q8izw2 antibodies proteins partial corresponding aa3 100 from tag mw alone 26kd sequence aqrrsllqseqqpswtddlplchlsgvgsasnrsysadgkgteshppedswlkfrsenncflygvfngydgnrvtnfvaqrlsaelllgqlnaehaea conjugate ph7.2 detected30 kit613 pc12 kinase1 mitogen7 aa3100
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
WB (Western Blot)||Western Blot analysis of SMAD3 expression in transfected 293T cell line by SMAD3 monoclonal antibody (M07), clone 1B7.<br><br>Lane 1: SMAD3 transfected lysate (48 KDa).<br>Lane 2: Non-transfected lysate.<br>||AAA26515_WB6.jpg!!WB (Western Blot)||SMAD3 monoclonal antibody (M07), clone 1B7. Western Blot analysis of SMAD3 expression in Raw 264.7 (Cat # L024V1).||AAA26515_WB5.jpg!!WB (Western Blot)||SMAD3 monoclonal antibody (M07), clone 1B7. Western Blot analysis of SMAD3 expression in PC-12 (Cat # L012V1).||AAA26515_WB4.jpg!!WB (Western Blot)||SMAD3 monoclonal antibody (M07), clone 1B7. Western Blot analysis of SMAD3 expression in NIH/3T3 (Cat # L018V1).||AAA26515_WB3.jpg!!Application Data||Detection limit for recombinant GST tagged SMAD3 is approximately 3ng/ml as a capture antibody.||AAA26515_APP2.jpg!!WB (Western Blot)||SMAD3 monoclonal antibody (M07), clone 1B7 Western Blot analysis of SMAD3 expression in HeLa (Cat # L013V1).||AAA26515_WB.jpg
⇄⧉etc_term1 => string (262) "Immunogen||SMAD3 (NP_005893, 1aa-110aa) partial recombinant protein with GST...
$value['hits']['hits'][4]['_source']['etc_term1']
Immunogen||SMAD3 (NP_005893, 1aa-110aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCE!!Conjugate||HRP
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (55) "ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)"
WB (Western Blot)||MAP3K7IP1 monoclonal antibody Western Blot analysis of MAP3K7IP1 expression in PC-12.||AAA25270_WB6.jpg!!Application Data||Proximity Ligation Analysis (PLA) of protein-protein interactions between HSPA1L and MAP3K7IP1 HeLa cells were stained with HSPA1L rabbit purified polyclonal 1:1200 and MAP3K7IP1 mouse monoclonal antibody 1:50. Signals were detected 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.||AAA25270_APP5.jpg!!Application Data||Detection limit for recombinant GST tagged MAP3K7IP1 is ~0.3ng/ml as a capture antibody.||AAA25270_APP4.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to MAP3K7IP1 on HeLa cell. [antibody concentration 10ug/ml]||AAA25270_IF3.jpg!!WB (Western Blot)||MAP3K7IP1 monoclonal antibody Western Blot analysis of MAP3K7IP1 expression in HeLa.||AAA25270_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (36.89kD).||AAA25270_WB.jpg
⇄⧉etc_term1 => string (266) "Immunogen||Partial recombinant corresponding to aa3-100 from MAP3K7IP1 (NP_7...
$value['hits']['hits'][5]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa3-100 from MAP3K7IP1 (NP_705717) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||AQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSENNCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNAEHAEA!!Conjugate||FITC
TAB1 (TGF-beta-activated Kinase 1 and MAP3K7-binding Protein 1, Mitogen-activated Protein Kinase Kinase Kinase 7-interacting Protein 1, TGF-beta-activated Kinase 1-binding Protein 1, TAK1-binding Protein 1, MAP3K7IP1) (FITC)
aaa25270 mouse human rat monoclonal igg1,k 2a12 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with fluorescein isothiocyanate fitc recognizes map3k7ip1 species crossreactivity elisa eia immunofluorescence if western blot wb 10ug ml applications are based on unconjugated antibody detection against immunogen 36.89kd aaa25270_wb analysis of expression hela aaa25270_wb2 to cell concentration aaa25270_if3 testing data limit for recombinant gst tagged is ~0.3ng capture aaa25270_td4 proximity ligation pla interactions between hspa1l and cells were stained rabbit polyclonal 1:1200 1:50 signals detected 30 kit 613 red nuclei counterstained dapi blue each dot represents the interaction complex aaa25270_td5 pc 12 aaa25270_wb6 tab1 tgf beta activated kinase 1 map3k7 binding mitogen 7 interacting tak1 isoform 3' 50kda 41281798 np_705717 q15750 nm_153497 q8izw2 antibodies proteins partial corresponding aa3 100 from tag mw alone 26kd sequence aqrrsllqseqqpswtddlplchlsgvgsasnrsysadgkgteshppedswlkfrsenncflygvfngydgnrvtnfvaqrlsaelllgqlnaehaea conjugate ph7.2 detected30 kit613 pc12 kinase1 mitogen7 aa3100
IF (Immunofluorescence)||Immunofluorescence analysis of U-2 OS cells using RALGDS antibody at dilution of 1:100. Blue: DAPI for nuclear staining.||AAA28359_IF6.jpg!!IF (Immunofluorescence)||Immunofluorescence analysis of L929 cells using RALGDS antibody at dilution of 1:100. Blue: DAPI for nuclear staining.||AAA28359_IF5.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human thyroid cancer using RALGDS antibody at dilution of 1:100 (40x lens).||AAA28359_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded rat brain using RALGDS antibody at dilution of 1:100 (40x lens).||AAA28359_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded mouse testis using RALGDS antibody at dilution of 1:100 (40x lens).||AAA28359_IHC2.jpg!!WB (Western Blot)||Western blot analysis of extracts of various cell lines, using RALGDS Rabbit pAb at 1:1000 dilution.<br />Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.<br />Lysates/proteins: 25ug per lane.<br />Blocking buffer: 3% nonfat dry milk in TBST.<br />Detection: ECL Basic Kit (RM00020).<br />Exposure time: 10s.||AAA28359_WB.jpg
⇄⧉etc_term1 => string (98) "Immunogen||Recombinant protein of human RALGDS.!!Positive Samples||U-87MG, M...
$value['hits']['hits'][6]['_source']['etc_term1']
Immunogen||Recombinant protein of human RALGDS.!!Positive Samples||U-87MG, Mouse ovary, Mouse lung
Background: Guanine nucleotide dissociation stimulators (GDSs, or exchange factors), such as RALGDS, are effectors of Ras-related GTPases (see MIM 190020) that participate in signaling for a variety of cellular processes.[supplied by OMIM, Nov 2010]
Colorectal Cancer Pathway||83106!!Colorectal Cancer Pathway||518!!EGFR1 Signaling Pathway||198782!!ErbB1 Downstream Signaling Pathway||138057!!NGF Signalling Via TRKA From The Plasma Membrane Pathway||106459!!Pancreatic Cancer Pathway||83108!!Pancreatic Cancer Pathway||520!!Pathways In Cancer||83105!!Signal Transduction Pathway||477114!!Signalling By NGF Pathway||106439
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
WB (Western Blot)||G3BP monoclonal antibody Western Blot analysis of G3BP expression in A-431||AAA24514_WB6.jpg!!WB (Western Blot)||Western blot analysis of G3BP over-expressed 293 cell line, cotransfected with G3BP Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with G3BP monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.||AAA24514_WB5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to G3BP on HeLa cell. [antibody concentration 10ug/ml]||AAA24514_IF4.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to G3BP on formalin-fixed paraffin-embedded human lymphoma. [antibody concentration 1ug/ml]||AAA24514_IHC3.jpg!!WB (Western Blot)||Western Blot analysis of G3BP expression in transfected 293T cell line by G3BP monoclonal antibody Lane 1: G3BP transfected lysate (52.2kD). Lane 2: Non-transfected lysate.||AAA24514_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (35.53kD).||AAA24514_WB.jpg
⇄⧉etc_term1 => string (253) "Immunogen||Partial recombinant corresponding to aa214-303 from G3BP (AAH0699...
$value['hits']['hits'][7]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa214-303 from G3BP (AAH06997) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||KPEPVLEETAPEDAQKSSSPAPADIAQTVQEDLRTFSWASVTSKNLPPSGAVPVTGIPPHVVKVPASQPRPESKPESQIPPQRPQRDQRV!!Conjugate||APC
1. Progressive loss of dopaminergic neurons induced by unilateral rotenone infusion into the medial forebrain bundle. Norazit A, Meedeniya AC, Nguyen MN, Mackay-Sim A.Brain Res. 2010 Aug 28.
aaa24514 mouse human monoclonal igg1,k 2f3 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with allophycocyanin apc recognizes g3bp elisa eia immunofluorescence if immunohistochemistry ihc western blot wb 10ug ml applications are based on unconjugated antibody detection against immunogen 35.53kd aaa24514_wb analysis of expression transfected 293t cell line lane 1 lysate 52.2kd 2 non aaa24514_wb2 immunoperoxidase to formalin fixed paraffin embedded lymphoma concentration 1ug aaa24514_ihc3 hela aaa24514_if4 over expressed 293 cotransfected validated chimera rnai or control probed gapdh 36.1kd used specificity and loading aaa24514_wb5 431 aaa24514_wb6 g3bp1 ras gtpase activating binding atp dependent dna helicase viii hdh gap sh3 domain homo sapiens mrna stress granule assembly factor 13,874 da 13937793 bc006997 q13283 q5hye9 antibodies rab rho proteins partial recombinant corresponding aa214 303 from aah06997 gst tag mw the alone is 26kd sequence kpepvleetapedaqkssspapadiaqtvqedlrtfswasvtsknlppsgavpvtgipphvvkvpasqprpeskpesqippqrpqrdqrv conjugate ph7.2 lane1 52.2kd2 expressed293 aaa24514_wb5431 aa214303
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (45) "Immunohistochemistry (IHC), Western Blot (WB)"
WB (Western Blot)||SMAD3 monoclonal antibody (M01), clone 2C12. Western Blot analysis of SMAD3 expression in Hs 181.Tes.||AAA26562_WB6.jpg!!WB (Western Blot)||SMAD3 monoclonal antibody (M01), clone 2C12. Western Blot analysis of SMAD3 expression in HeLa.||AAA26562_WB5.jpg!!WB (Western Blot)||Western Blot analysis of SMAD3 expression in transfected 293T cell line by SMAD3 monoclonal antibody (M01), clone 2C12.<br><br>Lane 1: SMAD3 transfected lysate (48 KDa).<br>Lane 2: Non-transfected lysate.<br>||AAA26562_WB4.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to SMAD3 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 6 ug/ml]||AAA26562_IHC3.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to SMAD3 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 6 ug/ml]||AAA26562_IHC2.jpg!!WB (Western Blot)||SMAD3 monoclonal antibody (M01), clone 2C12. Western Blot analysis of SMAD3 expression in human colon.||AAA26562_WB.jpg
⇄⧉etc_term1 => string (255) "Immunogen||SMAD3 (NP_005893, 120aa-221aa) partial recombinant protein with G...
$value['hits']['hits'][8]['_source']['etc_term1']
Immunogen||SMAD3 (NP_005893, 120aa-221aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||VCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDL!!Conjugate||PE
The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein functions as a transcriptional modulator activated by transforming growth factor-beta and is thought to play a role in the regulation of carcinogenesis. [provided by RefSeq]
aaa26562 mouse monoclonal igg2a,k 2c12 purified supplied as a liquid in pbs ph 7.2 no preservative added labeled with r phycoerythrin pe recognizes smad3 immunohistochemistry ihc western blot wb applications are based on unconjugated antibody m01 clone analysis of expression human colon aaa26562_wb immunoperoxidase to formalin fixed paraffin embedded tonsil concentration 6 ug ml aaa26562_ihc2 aaa26562_ihc3 transfected 293t cell line by lane 1 lysate 48 kda 2 non aaa26562_wb4 hela aaa26562_wb5 hs 181.tes aaa26562_wb6 smad family member 3 dkfzp586n0721 dkfzp686j10186 hspc193 hst17436 jv15 madh3 mgc60396 mothers against decapentaplegic homolog isoform lds3 lds1c 50.2 445aa confirmed maldi tof mad mad3 dpp hmad hsmad3 smad3_human 5174513 np_005893 p84022 nm_005902.3 o09064 o09144 o14510 o35273 q92940 q93002 a8k4b6 b7z4z5 b7z6m9 b7z9q2 f5h383 114500 antibodies proteins immunogen 120aa 221aa partial recombinant protein gst tag mw the alone is 26kd sequence vcvnpyhyqrvetpvlppvlvprhteipaefpplddyshsipentnfpagiepqsnipetpppgylsedgetsdhqmnhsmdagspnlspnpmspahnnldl conjugate ph7.2 concentration6 lane1 lysate48 kda2 member3
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (70) "Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)"
Application Data||Detection limit for recombinant GST tagged STIP1 is approximately 0.03ng/ml as a capture antibody.||AAA26582_APP6.jpg!!WB (Western Blot)||STIP1 monoclonal antibody (M11), clone 1E3 Western Blot analysis of STIP1 expression in HeLa (Cat # L013V1).||AAA26582_WB5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26582_IF4.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to STIP1 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26582_IF3.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to STIP1 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]||AAA26582_IHC2.jpg!!Application Data||Immunoperoxidase of monoclonal antibody to STIP1 on formalin-fixed paraffin-embedded human lung. [antibody concentration 3 ug/ml]||AAA26582_APP.jpg
Immunogen||STIP1 (NP_006810.1, 445aa-543aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||TKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR!!Conjugate||PE
STIP1 is an adaptor protein that coordinates the functions of HSP70 (see HSPA1A; MIM 140550) and HSP90 (see HSP90AA1; MIM 140571) in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, suggesting that it regulates both the conformations and ATPase cycles of these chaperones (Song and Masison, 2005 [PubMed 16100115]). [supplied by OMIM]
⇄⧉products_references => string (209) "1. Glaucoma-associated WDR36 variants encode functional defects in a yeast m...
1. Glaucoma-associated WDR36 variants encode functional defects in a yeast model system. Footz TK, Johnson JL, Dubois S, Boivin N, Raymond V, Walter MA.Hum Mol Genet. 2009 Apr1;18(7):1276-87. Epub 2009 Jan 15.
⇄⧉products_related_diseases => string (235) "Inflammation||7!!Nervous System Diseases||7!!Brain Diseases||4!!Liver Diseas...
aaa26582 mouse monoclonal igg2a,k 1000 purified supplied as a liquid in pbs ph 7.2 no preservative added labeled with r phycoerythrin pe recognizes stip1 immunofluorescence if immunohistochemistry ihc western blot wb applications are based on unconjugated antibody testing data immunoperoxidase of to formalin fixed paraffin embedded human lung concentration 3 ug ml aaa26582_td aaa26582_ihc2 hela cell 10 aaa26582_if3 aaa26582_if4 m11 clone 1e3 analysis expression cat # l013v1 aaa26582_wb5 detection limit for recombinant gst tagged is approximately 0.03ng capture aaa26582_td6 stress induced phosphoprotein 1 hop ief ssp 3521 p60 sti1 sti1l isoform b hel s 94n ny ren 11 antigen hsp70 hsp90 organizing protein hsc70 renal carcinoma transformation sensitive epididymis secretory sperm binding li 62,639 da stip1_human 5803181 np_006810.1 p31948 nm_006819.2 q3zcu9 q5tzu9 b4dm70 f5h0t1 g3xad8 605063 antibodies proteins immunogen 445aa 543aa partial tag mw the alone 26kd sequence tkamdvyqkaldldssckeaadgyqrcmmaqynrhdspedvkrramadpevqqimsdpamrlileqmqkdpqalsehlknpviaqkiqklmdvgliair conjugate ph7.2 concentration3 cell10 clone1e3 phosphoprotein1 ren11
WB 1:500 - 1:2000<br>IHC-P 1:50 - 1:200<br>IF/ICC 1:50 - 1:200<br>ELISA: Recommended starting concentration is 1 ug/mL. Please optimize the concentration based on your specific assay requirements.
IF (Immunofluorescence)||Immunofluorescence analysis of U2OS cells usingTFEB Rabbit pAb (AAA28118) at dilution of 1:50 (40xlens).<br>Secondary antibody: Cy3 Goat Anti-Rabbit IgG(H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.||AAA28118_IF8.jpg!!IF (Immunofluorescence)||Immunofluorescence analysis of PC-12 cells usingTFEB Rabbit pAb (AAA28118) at dilution of 1:50 (40xlens).<br>Secondary antibody: Cy3 Goat Anti-Rabbit IgG(H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.||AAA28118_IF7.jpg!!IF (Immunofluorescence)||Immunofluorescence analysis of NIH/3T3 cells usingTFEB Rabbit pAb (AAA28118) at dilution of 1:50 (40xlens).<br>Secondary antibody: Cy3 Goat Anti-Rabbit IgG(H+L) at 1:500 dilution. Blue: DAPI fornuclear staining.||AAA28118_IF6.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry analysis of TFEB in paraffin-embedded rat testis tissue using TFEB Rabbit pAb (AAA28118) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01M citrate buffer (pH 6.0) prior to IHC staining.||AAA28118_IHC5.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry analysis of TFEB in paraffin-embedded mouse lung tissue using TFEB Rabbit pAb (AAA28118) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01M citrate buffer (pH 6.0) prior to IHC staining.||AAA28118_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry analysis of TFEB in paraffin-embedded human colon tissue using TFEB Rabbit pAb (AAA28118) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01M citrate buffer (pH 6.0) prior to IHC staining.||AAA28118_IHC3.jpg!!WB (Western Blot)||Western blot analysis of lysates from wild type (WT) and TFEB knockdown (KD) HeLa cells using [KD Validated] TFEB Rabbit pAb (AAA28118) at 1:1000 dilution incubated overnight at 4 degrees C.<br>Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.<br>Lysates/proteins: 25 ug per lane.<br>Blocking buffer: 3% nonfat dry milk in TBST.<br>Detection: ECL Basic Kit.<br>Exposure time: 10s.||AAA28118_WB2.jpg!!WB (Western Blot)||Western blot analysis of various lysates, using TFEB Rabbit pAb (AAA28118) at 1:1000 dilution.<br>Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.<br>Lysates/proteins: 25ug per lane.<br>Blocking buffer: 3% nonfat dry milk in TBST.<br>Detection: ECL Basic Kit.<br>Exposure time: 180s.||AAA28118_WB.jpg
⇄⧉etc_term1 => string (123) "Immunogen||Recombinant fusion protein containing a sequence corresponding to...
Background: Enables DNA-binding transcription factor activity; enzyme binding activity; and transcription cis-regulatory region binding activity. Involved in several processes, including cellular response to amino acid starvation; lysosome localization; and positive regulation of autophagy. Located in cytosol; lysosomal membrane; and nucleoplasm.
⇄⧉products_references => string (442) "Horibe A, Eid N, Ito Y, et al. <a href="http://www.mdpi.com/1422-0067/18/5/1...
Horibe A, Eid N, Ito Y, et al. <a href="http://www.mdpi.com/1422-0067/18/5/1061" rel="nofollow" target="_blank">Upregulated autophagy in Sertoli cells of ethanol-treated rats is associated with induction of inducible nitric oxide synthase (iNOS), Androgen Receptor Suppression and Germ Cell Apoptosis Int. J. Mol. Sci. 2017, 18(5), 1061; doi: 10.3390/ijms18051061.</a> The TFEB pAb was used for WB, IHC (paraffin) and IF in the publication.
⇄⧉products_related_diseases => string (197) "Kidney Diseases||45!!Adenocarcinoma||42!!Death||20!!Nervous System Diseases|...
IF (Immunofluorescence)||Immunofluorescence analysis of U-2 OS cells using PTRF antibody at dilution of 1:100. Blue: DAPI for nuclear staining.||AAA28370_IF6.jpg!!IF (Immunofluorescence)||Immunofluorescence analysis of L929 cells using PTRF antibody at dilution of 1:100. Blue: DAPI for nuclear staining.||AAA28370_IF5.jpg!!IF (Immunofluorescence)||Immunofluorescence analysis of C6 cells using PTRF antibody at dilution of 1:100. Blue: DAPI for nuclear staining.||AAA28370_IF4.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded Rat spleen using PTRF Rabbit pAb at dilution of 1:100 (40x lens).||AAA28370_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded Human placenta using PTRF Rabbit pAb at dilution of 1:100 (40x lens).||AAA28370_IHC2.jpg!!WB (Western Blot)||Western blot analysis of extracts of various cell lines, using PTRF antibody at 1:1000 dilution.<br />Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.<br />Lysates/proteins: 25ug per lane.<br />Blocking buffer: 3% nonfat dry milk in TBST.<br />Detection: ECL Basic Kit (RM00020).<br />Exposure time: 10s.||AAA28370_WB.jpg
⇄⧉etc_term1 => string (136) "Immunogen||Recombinant protein of human PTRF.!!Positive Samples||HT-1080, He...
Background: This gene encodes a protein that enables the dissociation of paused ternary polymerase I transcription complexes from the 3' end of pre-rRNA transcripts. This protein regulates rRNA transcription by promoting the dissociation of transcription complexes and the reinitiation of polymerase I on nascent rRNA transcripts. This protein also localizes to caveolae at the plasma membrane and is thought to play a critical role in the formation of caveolae and the stabilization of caveolins. This protein translocates from caveolae to the cytoplasm after insulin stimulation. Caveolae contain truncated forms of this protein and may be the site of phosphorylation-dependent proteolysis. This protein is also thought to modify lipid metabolism and insulin-regulated gene expression. Mutations in this gene result in a disorder characterized by generalized lipodystrophy and muscular dystrophy.
Gene Expression Pathway||105937!!RNA Polymerase I Transcription Pathway||106550!!RNA Polymerase I Transcription Termination Pathway||106556!!RNA Polymerase I, RNA Polymerase III, And Mitochondrial Transcription Pathway||160948
⇄sp_protein_name => string (42) "Polymerase I and transcript release factor"
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
WB (Western Blot)||DNAJC10 monoclonal antibody. Western Blot analysis of DNAJC10 expression in HeLa.||AAA24784_WB7.jpg!!WB (Western Blot)||DNAJC10 monoclonal antibody. Western Blot analysis of DNAJC10 expression in Raw 264.7.||AAA24784_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged DNAJC10 is ~10ng/ml as a capture antibody.||AAA24784_APP5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to DNAJC10 on HeLa cell. [antibody concentration 10ug/ml].||AAA24784_IF4.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to DNAJC10 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3ug/ml].||AAA24784_IHC3.jpg!!WB (Western Blot)||DNAJC10 monoclonal antibody. Western Blot analysis of DNAJC10 expression in NIH/3T3.||AAA24784_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (37.77kD).||AAA24784_WB.jpg
⇄⧉etc_term1 => string (282) "Immunogen||Partial recombinant corresponding to aa688-794 from human DNAJC10...
Immunogen||Partial recombinant corresponding to aa688-794 from human DNAJC10 (NP_061854) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||KNHWVIDFYAPWCGPCQNFAPEFELLARMIKGKVKAGKVDCQAYAQTCQKAGIRAYPTVKFYFYERAKRNFQEEQINTRDAKAIAALISEKLETLRNQGKRNKDEL!!Conjugate||Biotin
aaa24784 mouse human rat monoclonal igg1,k 3c4 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with biotin recognizes dnajc10 species crossreactivity and elisa eia immunofluorescence if immunohistochemistry ihc western blot wb 10ug ml applications are based on unconjugated antibody detection against immunogen 37.77kd aaa24784_wb analysis of expression nih 3t3 aaa24784_wb2 immunoperoxidase to formalin fixed paraffin embedded stomach concentration 3ug aaa24784_ihc3 hela cell aaa24784_if4 testing data limit for recombinant gst tagged is ~10ng capture aaa24784_td5 raw 264.7 aaa24784_wb6 aaa24784_wb7 dnaj homolog subfamily c member 10 er resident erdj5 macrothioredoxin mthr unq495 pro1012 dkfzp434j1813 mgc104194 isoform 2 heat shock family hsp40 c10 jpdi pdia19 91kda endoplasmic reticulum dna j domain containing 5 djc10_human 409971397 np_061854 q8ixb1 nm_018981 607987 antibodies proteins partial corresponding aa688 794 from tag mw the alone 26kd sequence knhwvidfyapwcgpcqnfapefellarmikgkvkagkvdcqayaqtcqkagirayptvkfyfyerakrnfqeeqintrdakaiaalisekletlrnqgkrnkdel conjugate ph7.2 member10 isoform2 containing5 aa688794
IF (Immunofluorescence)||Immunofluorescence analysis of U-2OS cells using Lipoprotein lipase (Lipoprotein lipase (LPL)) antibody at dilution of 1:100. Blue: DAPI for nuclear staining.||AAA28325_IF4.jpg!!IF (Immunofluorescence)||Immunofluorescence analysis of NIH/3T3 cells using Lipoprotein lipase (Lipoprotein lipase (LPL)) antibody at dilution of 1:100. Blue: DAPI for nuclear staining.||AAA28325_IF3.jpg!!IF (Immunofluorescence)||Immunofluorescence analysis of C6 cells using Lipoprotein lipase (Lipoprotein lipase (LPL)) antibody at dilution of 1:100. Blue: DAPI for nuclear staining.||AAA28325_IF2.jpg!!WB (Western Blot)||Western blot analysis of extracts of various cell lines, using Lipoprotein lipase (Lipoprotein lipase (LPL)) antibody at 1:1000 dilution.<br>Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.<br>Lysates/proteins: 25ug per lane.<br>Blocking buffer: 3% nonfat dry milk in TBST.<br>Detection: ECL Basic Kit (RM00020).<br>Exposure time: 1s.||AAA28325_WB.jpg
⇄⧉etc_term1 => string (165) "Immunogen||Recombinant fusion protein containing a sequence corresponding to...
Immunogen||Recombinant fusion protein containing a sequence corresponding to amino acids 124-475 of human Lipoprotein lipase (Lipoprotein lipase (LPL))(NP_000228.1).
Background: LPL encodes lipoprotein lipase, which is expressed in heart, muscle, and adipose tissue. LPL functions as a homodimer, and has the dual functions of triglyceride hydrolase and ligand/bridging factor for receptor-mediated lipoprotein uptake. Severe mutations that cause LPL deficiency result in type I hyperlipoproteinemia, while less extreme mutations in LPL are linked to many disorders of lipoprotein metabolism.
IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded mouse spleen using PAXIP1 Rabbit pAb at dilution of 1:100 (40x lens).||AAA28350_IHC7.jpg!!IHC (Immunohistchemistry)||Immunohistochemistry of paraffin-embedded mouse brain using PAXIP1 Rabbit pAb at dilution of 1:100 (40x lens).||AAA28350_IHC6.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human breast cancer using PAXIP1 Rabbit pAb at dilution of 1:100 (40x lens).||AAA28350_IHC5.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human thyroid cancer using PAXIP1 Rabbit pAb at dilution of 1:100 (40x lens).||AAA28350_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded rat spleen using PAXIP1 Rabbit pAb at dilution of 1:100 (40x lens).||AAA28350_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded rat ovary using PAXIP1 Rabbit pAb at dilution of 1:100 (40x lens).||AAA28350_IHC2.jpg!!WB (Western Blot)||Western blot analysis of extracts of various cell lines, using PAXIP1 antibody at 1:500 dilution.<br />Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.<br />Lysates/proteins: 25ug per lane.<br />Blocking buffer: 3% nonfat dry milk in TBST.<br />Detection: ECL Enhanced Kit (RM00021).<br />Exposure time: 180s.||AAA28350_WB.jpg
⇄⧉etc_term1 => string (123) "Immunogen||Recombinant protein of human PAXIP1.!!Cellular Location||Nucleus ...
Background: This gene is a member of the paired box (PAX) gene family and encodes a nuclear protein with six BRCT (breast cancer carboxy-terminal) domains. This protein plays a critical role in maintaining genome stability, condensation of chromatin and progression through mitosis.
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (67) "ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)"
Application Data||Detection limit for recombinant GST tagged MECP2 is ~1ng/ml as a capture antibody.||AAA24270_APP7.jpg!!IHC (Immunohistchemistry)||Immunoperoxidase of monoclonal antibody to MECP2 on formalin-fixed paraffin-embedded human heart. [antibody concentration 3ug/ml]||AAA24270_IHC6.jpg!!WB (Western Blot)||Western Blot analysis of MECP2 expression in transfected 293T cell line by MECP2 monoclonal antibody. Lane 1: MECP2 transfected lysate (52.4kD). Lane 2: Non-transfected lysate.||AAA24270_WB5.jpg!!WB (Western Blot)||MECP2 monoclonal antibody. Western Blot analysis of MECP2 expression in NIH/3T3.||AAA24270_WB4.jpg!!WB (Western Blot)||MECP2 monoclonal antibody Western Blot analysis of MECP2 expression in MCF-7,||AAA24270_WB3.jpg!!WB (Western Blot)||MECP2 monoclonal antibody. Western Blot analysis of MECP2 expression in rat muscle.||AAA24270_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (35.53kD).||AAA24270_WB.jpg
⇄⧉etc_term1 => string (258) "Immunogen||Partial recombinant corresponding to aa81-170 from human MECP2 (A...
Immunogen||Partial recombinant corresponding to aa81-170 from human MECP2 (AAH11612) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||PKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQ!!Conjugate||AP
aaa24270 mouse human rat monoclonal igg2a,k 4b6 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with alkaline phosphatase ap recognizes mecp2 species crossreactivity and elisa eia immunohistochemistry ihc paraffin western blot wb p 3ug ml applications are based on unconjugated antibody detection against immunogen 35.53kd aaa24270_wb analysis of expression muscle aaa24270_wb2 mcf 7 aaa24270_wb3 nih 3t3 aaa24270_wb4 transfected 293t cell line lane 1 lysate 52.4kd 2 non aaa24270_wb5 immunoperoxidase to formalin fixed embedded heart concentration aaa24270_ihc6 testing data limit for recombinant gst tagged is ~1ng capture aaa24270_td7 methyl cpg binding mecp dkfzp686a24160 homo sapiens rett syndrome mrna rs rts rtt ppmx mrx16 mrx79 mrxsl autsx3 mrxs13 53,323 da 15079579 bc011612 aah11612 p51608 o15233 q6qhh9 q7z384 antibodies proteins partial corresponding aa81 170 from tag mw the alone 26kd sequence pkqrrsiirdrgpmyddptlpegwtrklkqrksgrsagkydvylinpqgkafrskveliayfekvgdtsldpndfdftvtgrgspsrreq conjugate ph7.2 mcf7 lane1 52.4kd2 aa81170
IF (Immunofluorescence)||Immunofluorescence analysis of HeLa cells using DNAJB6 antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.||AAA28129_IF8.jpg!!IF (Immunofluorescence)||Immunofluorescence analysis of U2OS cells using DNAJB6 antibody. Blue: DAPI for nuclear staining.||AAA28129_IF7.jpg!!IHC (Immunohistchemistry)||Immunohistochemistry of paraffin-embedded mouse ileum using DNAJB6 antibody at dilution of 1:100 (40x lens).||AAA28129_IHC6.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human stomach using DNAJB6 antibody at dilution of 1:100 (40x lens).||AAA28129_IHC5.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human kidney cancer using DNAJB6 antibody at dilution of 1:100 (40x lens).||AAA28129_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human kidney using DNAJB6 antibody at dilution of 1:100 (40x lens).||AAA28129_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human well-differentiated squamous skin carcinoma using DNAJB6 antibody at dilution of 1:100 (40x lens).||AAA28129_IHC2.jpg!!WB (Western Blot)||Western blot analysis of extracts of various cell lines, using DNAJB6 antibody at 1:1000 dilution.<br>Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.<br>Lysates/proteins: 25ug per lane.<br>Blocking buffer: 3% nonfat dry milk in TBST.<br>Detection: ECL Basic Kit.<br>Exposure time: 10s.||AAA28129_WB.jpg
This gene encodes a member of the DNAJ protein family. DNAJ family members are characterized by a highly conserved amino acid stretch called the 'J-domain' and function as one of the two major classes of molecular chaperones involved in a wide range of cellular events, such as protein folding and oligomeric protein complex assembly. This family member may also play a role in polyglutamine aggregation in specific neurons. Alternative splicing of this gene results in multiple transcript variants; however, not all variants have been fully described.
IF (Immunofluorescence)||Immunofluorescence analysis of U2OS cells using UHRF1 antibody. Blue: DAPI for nuclear staining.||AAA10713_IF7.jpg!!IHC (Immunohistchemistry)||Immunohistochemistry of paraffin-embedded human gastric cancer using UHRF1 antibody at dilution of 1:100 (40x lens).||AAA10713_IHC6.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human colon carcinoma using UHRF1 antibody at dilution of 1:100 (40x lens).||AAA10713_IHC5.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human colon using UHRF1 antibody at dilution of 1:100 (40x lens).||AAA10713_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human lung cancer using UHRF1 antibody at dilution of 1:100 (40x lens).||AAA10713_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human tonsil using UHRF1 antibody at dilution of 1:100 (40x lens).||AAA10713_IHC2.jpg!!WB (Western Blot)||Western blot analysis of extracts of various cell lines, using UHRF1 antibody at 1:1000 dilution.<br>Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.<br>Lysates/proteins: 25ug per lane.<br>Blocking buffer: 3% nonfat dry milk in TBST.||AAA10713_WB.jpg
UHRF1, also named as ICBP90, NP95 and RNF106, is a putative E3 ubiquitin-protein ligase. It may participate in methylation-dependent transcriptional regulation. UHRF1 binds to inverted 5'-CCAAT-3' box 2 in the TOP2A promoter, and activates TOP2A expression. It is important for G1/S transition and may be involved in DNA repair and chromosomal stability. UHRF1's ability to repress its direct target gene expression is dependent on PHD(UHRF1) binding to unmodified H3R2.
E3 ubiquitin-protein ligase UHRF1; nuclear protein 95; RING finger protein 106; nuclear phosphoprotein 95; transcription factor ICBP90; nuclear zinc finger protein Np95; inverted CCAAT box-binding protein of 90 kDa; ubiquitin-like PHD and RING finger domain-containing protein 1
Inverted CCAAT box-binding protein of 90 kDa; Nuclear protein 95; Nuclear zinc finger protein Np95; HuNp95; hNp95; RING finger protein 106; Transcription factor ICBP90; Ubiquitin-like PHD and RING finger domain-containing protein 1; hUHRF1; Ubiquitin-like-containing PHD and RING finger domains protein 1
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.<br><br>FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (42) "Immunofluorescence (IF), Western Blot (WB)"
WB (Western Blot)||RPS6KB1 monoclonal antibody (M04), clone 4H4. Western Blot analysis of RPS6KB1 expression in PC-12.||AAA26371_WB6.jpg!!WB (Western Blot)||RPS6KB1 monoclonal antibody (M04), clone 4H4. Western Blot analysis of RPS6KB1 expression in NIH/3T3.||AAA26371_WB5.jpg!!Application Data||Detection limit for recombinant GST tagged RPS6KB1 is approximately 0.1ng/ml as a capture antibody.||AAA26371_APP4.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to RPS6KB1 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26371_IF3.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to RPS6KB1 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26371_IF2.jpg!!WB (Western Blot)||RPS6KB1 monoclonal antibody (M04), clone 4H4 Western Blot analysis of RPS6KB1 expression in HeLa (Cat # L013V1).||AAA26371_WB.jpg
Immunogen||RPS6KB1 (NP_003152, 416aa-525aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||PSVLESVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL!!Conjugate||FITC
This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates several residues of the S6 ribosomal protein. The kinase activity of this protein leads to an increase in protein synthesis and cell proliferation. Amplification of the region of DNA encoding this gene and overexpression of this kinase are seen in some breast cancer cell lines. Alternate translational start sites have been described and alternate transcriptional splice variants have been observed but have not been thoroughly characterized. [provided by RefSeq]
IF (Immunofluorescence)||Immunofluorescence analysis of HeLa cells using TRAP1 antibody. Blue: DAPI for nuclear staining.||AAA10761_IF8.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded mouse heart using TRAP1 Antibody at dilution of 1:100 (40x lens).||AAA10761_IHC7.jpg!!IHC (Immunohistchemistry)||Immunohistochemistry of paraffin-embedded mouse brain using TRAP1 Antibody at dilution of 1:100 (40x lens).||AAA10761_IHC6.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded rat heart using TRAP1 Antibody at dilution of 1:100 (40x lens).||AAA10761_IHC5.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded rat brain using TRAP1 Antibody at dilution of 1:100 (40x lens).||AAA10761_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded rat skeletal muscle using TRAP1 Antibody at dilution of 1:100 (40x lens).||AAA10761_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded rat brain using TRAP1 Antibody at dilution of 1:200 (40x lens).||AAA10761_IHC2.jpg!!WB (Western Blot)||Western blot analysis of extracts of various cell lines, using TRAP1 antibody at 1:1000 dilution.<br>Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.<br>Lysates/proteins: 25ug per lane.<br>Blocking buffer: 3% nonfat dry milk in TBST.<br>Detection: ECL Basic Kit.<br>Exposure time: 30s.||AAA10761_WB.jpg
This gene encodes a mitochondrial chaperone protein that is member of the heat shock protein 90 (HSP90) family. The encoded protein has ATPase activity and interacts with tumor necrosis factor type I. This protein may function in regulating cellular stress responses. Alternate splicing results in multiple transcript variants.
The OmniKine Murine JE/MCP-1 ELISA is capable of recognizing both recombinant and naturally produced Murine JE/MCP-1 proteins. The antigens listed below were tested at 50 ng/ml and exhibited 100% cross reactivity.<br>Rat: MCP-1<br>The antigens listed below were tested at 50 ng/ml and exhibited less than 2% cross reactivity.<br>Murine: MCP-3<br>The antigens listed below were tested at 50 ng/ml and exhibited less than 1% cross reactivity.<br>Human: MCP-1, MCP-3<br>Murine: MCP-5<br>The antigens listed below were tested at 50 ng/ml and did not exhibit significant cross reactivity or interference.<br>Human: CTACK, MCP-2, MIP-4, MIP-1beta<br>Murine: C10, CTACK, Eotaxin, KC, MCP-2, MDC, MIP-1alpha, MIP-1beta, MIP-1gamma, MIP-3beta, RANTES
Samples||Detection And Quantification Of Human Pcsk9 Concentrations In Cell Lysates, Sera And Plasma!!Assay Type||Quantitative Sandwich!!Sensitivity||125-8000 pg/ml.
Principle of the Assay: The OmniKine Human PCSK9 ELISA Kit contains the components necessary for quantitative determination of natural or recombinant Human PCSK9 concentrations within any experimental sample including cell lysates, serum and plasma. This particular immunoassay utilizes the quantitative technique of a "Sandwich" Enzyme-Linked Immunosorbent Assay (ELISA) where the target protein (antigen) is bound in a "sandwich" format by the primary capture antibodies coated to each well-bottom and the secondary detection antibodies added subsequently by the investigator. The capture antibodies coated to the bottom of each well are specific for a particular epitope on Human PCSK9 while the user-added detection antibodies bind to epitopes on the captured target protein. Amid each step of the procedure, a series of wash steps must be performed to ensure the elimination of non-specific binding between proteins to other proteins or to the solid phase. After incubation and "sandwiching" of the target antigen, a peroxidase enzyme is conjugated to the constant heavy chain of the secondary antibody (either covalently or via Avidin/Streptavidin-Biotin interactions), allowing for a colorimetric reaction to ensue upon substrate addition. When the substrate TMB (3, 3', 5, 5'-Tetramethylbenzidine) is added, the reaction catalyzed by peroxidase yields a blue color that is representative of the antigen concentration. Upon sufficient color development, the reaction can be terminated through addition of Stop Solution (2 N Sulfuric Acid) where the color of the solution will turn yellow. The absorbance of each well can then be read by a spectrophotometer, allowing for generation of a standard curve and subsequent determination of protein concentration!!Background/Introduction: Proprotein Convertase 9/PCSK9 may be implicated in the differentiation of cortical neurons and may play a role in cholesterol homeostasis. The enzyme is inhibited by EGTA. PCSK9 is expressed in neuro-epithelioma, colon carcinoma, hepatic and pancreatic cell lines, and in Schwann cells. The soluble zymogen undergoes autocatalytic intramolecular processing in the endoplasmic reticulum, resulting in the cleavage of its propeptide that remains associated with the secreted enzyme. Variant Leu-23 insertion polymorphism in PCSK9 might have a modifier effect on LDLR mutation and familial hypercholesterolemia. Defects in PCSK9 are the cause of hypercholesterolemia autosomal dominant type 3 (HCHOLA3), a familial condition characterized by elevated circulating cholesterol contained in either low-density lipoproteins alone or also in very-low-density lipoproteins.
aaa30735 mouse 12 x 8 well microstrips the omnikine murine je mcp 1 elisa is capable of recognizing both recombinant and naturally produced proteins antigens listed below were tested at 50 ng ml exhibited 100 cross reactivity rat less than 2 3 human 5 did not exhibit significant or interference ctack mip 4 1beta c10 eotaxin kc mdc 1alpha 1gamma 3beta rantes typical testing data standard curve for reference only aaa30735_sc kit c motif chemokine monocyte chemoattractant protein chemotactic platelet derived growth factor inducible small cytokine a2 scya2 ccl2 ligand hc11 mcaf mcp1 sigje smc cf ai323594 16,326 da 6755430 np_035463.1 p10148 nm_011333.3 q9qyd7 samples detection quantification pcsk9 concentrations in cell lysates sera plasma assay type quantitative sandwich sensitivity 125 8000 pg mouse12 x8 at50 exhibited100 than2 human5 mip4 sensitivity125
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (42) "Immunofluorescence (IF), Western Blot (WB)"
WB (Western Blot)||RPS6KB1 monoclonal antibody (M04), clone 4H4. Western Blot analysis of RPS6KB1 expression in PC-12.||AAA26636_WB6.jpg!!WB (Western Blot)||RPS6KB1 monoclonal antibody (M04), clone 4H4. Western Blot analysis of RPS6KB1 expression in NIH/3T3.||AAA26636_WB5.jpg!!Application Data||Detection limit for recombinant GST tagged RPS6KB1 is approximately 0.1ng/ml as a capture antibody.||AAA26636_APP4.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to RPS6KB1 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26636_IF3.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to RPS6KB1 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26636_IF2.jpg!!WB (Western Blot)||RPS6KB1 monoclonal antibody (M04), clone 4H4 Western Blot analysis of RPS6KB1 expression in HeLa (Cat # L013V1).||AAA26636_WB.jpg
Immunogen||RPS6KB1 (NP_003152, 416aa-525aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||PSVLESVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL!!Conjugate||PE
This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates several residues of the S6 ribosomal protein. The kinase activity of this protein leads to an increase in protein synthesis and cell proliferation. Amplification of the region of DNA encoding this gene and overexpression of this kinase are seen in some breast cancer cell lines. Alternate translational start sites have been described and alternate transcriptional splice variants have been observed but have not been thoroughly characterized. [provided by RefSeq]
aaa26636 mouse monoclonal igg1,k 4h4 purified supplied as a liquid in pbs ph 7.2 no preservative added labeled with r phycoerythrin pe recognizes rps6kb1 immunofluorescence if western blot wb applications are based on unconjugated antibody m04 clone analysis of expression hela cat # l013v1 aaa26636_wb to cell concentration 10 ug ml aaa26636_if2 aaa26636_if3 testing data detection limit for recombinant gst tagged is approximately 0.1ng capture aaa26636_td4 nih 3t3 aaa26636_wb5 pc 12 aaa26636_wb6 ribosomal protein s6 kinase 70kd polypeptide 1 ps6k s6k s6k1 stk14a p70 alpha beta isoform b1 s6ka 60.2kda 533aa 70 100kda sds page under reducing conditions kda p70s6k1 i serine threonine 14a ks6b1_human 4506737 np_003152 p23443 nm_003161.3 q7z721 b2r779 b4dlt4 b4dtg1 e7esb8 f6uym1 608938 antibodies proteins immunogen 416aa 525aa partial tag mw the alone 26kd sequence psvlesvkekfsfepkirsprrfigsprtpvspvkfspgdfwgrgasastanpqtpveypmetsgieqmdvtmsgeasaplpirqpnsgpykkqafpmiskrpehlrmnl conjugate ph7.2 concentration10 pc12 polypeptide1 533aa70
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (67) "ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)"
WB (Western Blot)||DDX54 monoclonal antibody, Western Blot analysis of DDX54 expression in HeLa.||AAA25370_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged DDX54 is 0.03ng/ml as a capture antibody.||AAA25370_APP5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to DDX54 on HeLa cell. [antibody concentration 10ug/ml].||AAA25370_IF4.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to DDX54 on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma. [antibody concentration 3ug/ml].||AAA25370_IHC3.jpg!!WB (Western Blot)||Western Blot analysis of DDX54 expression in transfected 293T cell line by DDX54 monoclonal antibody. Lane 1: DDX54 transfected lysate (98.6kD). Lane 2: Non-transfected lysate.||AAA25370_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (37.55kD).||AAA25370_WB.jpg
⇄⧉etc_term1 => string (275) "Immunogen||Partial recombinant corresponding to aa778-882 from human DDX54 (...
Immunogen||Partial recombinant corresponding to aa778-882 from human DDX54 (NP_076977) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||DDRDSDEEGASDRRGPERRGGKRDRGQGASRPHAPGTPAGRVRPELKTKQQILKQRRRAQKLHFLQRGGLKQLSARNRRRVQELQQGAFGRGARSKKGKMRKRM!!Conjugate||HRP
aaa25370 mouse human monoclonal igg2a,k 2h6 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with horseradish peroxidase hrp recognizes ddx54 elisa eia immunohistochemistry ihc paraffin western blot wb p 3ug ml applications are based on unconjugated antibody detection against immunogen 37.55kd aaa25370_wb analysis of expression transfected 293t cell line lane 1 lysate 98.6kd 2 non aaa25370_wb2 immunoperoxidase to formalin fixed embedded ovary clear carcinoma concentration aaa25370_ihc3 immunofluorescence if hela 10ug aaa25370_if4 testing data limit for recombinant gst tagged is 0.03ng capture aaa25370_td5 aaa25370_wb6 atp dependent rna helicase dp97 dead box 97kd 54 mgc2835 isoform 97kda 97 kda ddx54_human 51094101 np_076977 q8tdd1 nm_024072 611665 antibodies proteins partial corresponding aa778 882 from tag mw the alone 26kd sequence ddrdsdeegasdrrgperrggkrdrgqgasrphapgtpagrvrpelktkqqilkqrrraqklhflqrgglkqlsarnrrrvqelqqgafgrgarskkgkmrkrm conjugate ph7.2 lane1 98.6kd2 97kd54 97kda97 aa778882
IF (Immunofluorescence)||Immunofluorescence analysis of U2OS cells using SOX5 antibody. Blue: DAPI for nuclear staining.||AAA10779_IF7.jpg!!IHC (Immunohistchemistry)||Immunohistochemistry of paraffin-embedded mouse brain using SOX5 antibody at dilution of 1:100 (40x lens).||AAA10779_IHC6.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human stomach using SOX5 antibody at dilution of 1:100 (40x lens).||AAA10779_IHC5.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human kidney cancer using SOX5 antibody at dilution of 1:100 (40x lens).||AAA10779_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human colon carcinoma using SOX5 antibody at dilution of 1:100 (40x lens).||AAA10779_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded rat kidney using SOX5 antibody at dilution of 1:100 (40x lens).||AAA10779_IHC2.jpg!!WB (Western Blot)||Western blot analysis of extracts of various cell lines, using SOX5 antibody at 1:1000 dilution.<br>Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.<br>Lysates/proteins: 25ug per lane.<br>Blocking buffer: 3% nonfat dry milk in TBST.<br>Detection: ECL Basic Kit.<br>Exposure time: 3s.||AAA10779_WB.jpg
This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The encoded protein may play a role in chondrogenesis. A pseudogene of this gene is located on chromosome 8. Multiple transcript variants encoding distinct isoforms have been identified for this gene.
Can be stored at 2 degree C to 8 degree C short term (1 week).<br>For long term storage, aliquot and store at -20 degree C or -80 degree C.<br>Avoid repeated freezing and thawing cycles.
PDIA6 is a member of the protein disulfide isomerase (PDI). PDI is an enzyme in the endoplasmic reticulum in eukaryotes or periplasmic space of prokaryotes that catalyzes the formation and breakage of disulfide bonds between cysteine residues within proteins as they fold. PDIA6 function as a chaperone that inhibits aggregation of misfolded proteins. It plays a role in platelet aggregation and activation by agonists such as convulxin, collagen and thrombin. Recombinant human PDIA6 protein, fused to His-tag at N-terminus, was expressed in E Coli and purified by using conventional chromatography techniques.
⇄⧉products_references => string (98) "Jordan P.A., et al. (2005) Blood 105:1500-1507; Kikuchi M., et al. (2002) J....
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (68) "Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB)"
WB (Western Blot)||Western Blot analysis of FTL expression in transfected 293T cell line by FTL monoclonal antibody (M16), clone X1.<br><br>Lane 1: FTL transfected lysate(20 KDa).<br>Lane 2: Non-transfected lysate.<br>||AAA26144_WB6.jpg!!WB (Western Blot)||Western blot analysis of FTL over-expressed 293 cell line, cotransfected with FTL Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with FTL monoclonal antibody (M16), clone X1. GAPDH (36.1 kDa) used as specificity and loading control.||AAA26144_WB5.jpg!!Application Data||Detection limit for recombinant GST tagged FTL is approximately 0.03ng/ml as a capture antibody.||AAA26144_APP4.jpg!!WB (Western Blot)||FTL monoclonal antibody (M16), clone X1 Western Blot analysis of FTL expression in K-562.||AAA26144_WB3.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to FTL on HeLa cell. [antibody concentration 10 ug/ml]||AAA26144_IF2.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to FTL on HeLa cell. [antibody concentration 10 ug/ml]||AAA26144_IF.jpg
⇄⧉etc_term1 => string (328) "Immunogen||FTL (AAH04245, 1aa-175aa) full-length recombinant protein with GS...
Immunogen||FTL (AAH04245, 1aa-175aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MSSQIRQNYSTDVEAAVNSLVNLYLQASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRGGRALFQDIKKPAEDEWGKTPDAMKAAMALEKKLNQALLDLHALGSARTDPHLCDFLETHFLDEEVKLIKKMGDHLTNLHRLGGPEAGLGEYLFERLTLKHD!!Conjugate||APC
This gene encodes the light subunit of the ferritin protein. Ferritin is the major intracellular iron storage protein in prokaryotes and eukaryotes. It is composed of 24 subunits of the heavy and light ferritin chains. Variation in ferritin subunit composition may affect the rates of iron uptake and release in different tissues. A major function of ferritin is the storage of iron in a soluble and nontoxic state. Defects in this light chain ferritin gene are associated with several neurodegenerative diseases and hyperferritinemia-cataract syndrome. This gene has multiple pseudogenes. [provided by RefSeq]
aaa26144 mouse monoclonal igg1,k x1 purified supplied as a liquid in pbs ph 7.2 no preservative added labeled with allophycocyanin apc recognizes ftl immunofluorescence if immunoprecipitation ip western blot wb applications are based on unconjugated antibody of to hela cell concentration 10 ug ml aaa26144_if aaa26144_if2 m16 clone analysis expression k 562 aaa26144_wb3 testing data detection limit for recombinant gst tagged is approximately 0.03ng capture aaa26144_td4 over expressed 293 line cotransfected validated chimera rnai lane 2 or non transfected control 1 probed gapdh 36.1 kda used specificity and loading aaa26144_wb5 293t by lysate 20 aaa26144_wb6 ferritin light polypeptide mgc71996 chain lftd nbia3 13279005 aah04245 p02792 antibodies serum proteins immunogen 1aa 175aa full length protein tag mw the alone 26kd sequence mssqirqnystdveaavnslvnlylqasytylslgfyfdrddvalegvshffrelaeekregyerllkmqnqrggralfqdikkpaedewgktpdamkaamalekklnqalldlhalgsartdphlcdflethfldeevklikkmgdhltnlhrlggpeaglgeylferltlkhd conjugate ph7.2 concentration10 k562 expressed293 lane2 control1 lysate20
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.<br><br>FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (68) "Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB)"
WB (Western Blot)||Western Blot analysis of FTL expression in transfected 293T cell line by FTL monoclonal antibody (M16), clone X1.<br><br>Lane 1: FTL transfected lysate (20 KDa).<br>Lane 2: Non-transfected lysate.||AAA26410_WB6.jpg!!WB (Western Blot)||Western blot analysis of FTL over-expressed 293 cell line, cotransfected with FTL Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with FTL monoclonal antibody (M16), clone X1. GAPDH (36.1 kDa) used as specificity and loading control.||AAA26410_WB5.jpg!!Application Data||Detection limit for recombinant GST tagged FTL is approximately 0.03ng/ml as a capture antibody.||AAA26410_APP4.jpg!!WB (Western Blot)||FTL monoclonal antibody (M16), clone X1 Western Blot analysis of FTL expression in K-562 (Cat # L009V1).||AAA26410_WB3.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to FTL on HeLa cell. [antibody concentration 10 ug/ml]||AAA26410_IF2.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to FTL on HeLa cell. [antibody concentration 10 ug/ml]||AAA26410_IF.jpg
⇄⧉etc_term1 => string (329) "Immunogen||FTL (AAH04245, 1aa-175aa) full-length recombinant protein with GS...
Immunogen||FTL (AAH04245, 1aa-175aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MSSQIRQNYSTDVEAAVNSLVNLYLQASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRGGRALFQDIKKPAEDEWGKTPDAMKAAMALEKKLNQALLDLHALGSARTDPHLCDFLETHFLDEEVKLIKKMGDHLTNLHRLGGPEAGLGEYLFERLTLKHD!!Conjugate||FITC
This gene encodes the light subunit of the ferritin protein. Ferritin is the major intracellular iron storage protein in prokaryotes and eukaryotes. It is composed of 24 subunits of the heavy and light ferritin chains. Variation in ferritin subunit composition may affect the rates of iron uptake and release in different tissues. A major function of ferritin is the storage of iron in a soluble and nontoxic state. Defects in this light chain ferritin gene are associated with several neurodegenerative diseases and hyperferritinemia-cataract syndrome. This gene has multiple pseudogenes. [provided by RefSeq]
aaa26410 mouse monoclonal igg1,k x1 purified supplied as a liquid in pbs ph 7.2 no preservative added labeled with fluorescein isothiocyanate fitc recognizes ftl immunofluorescence if immunoprecipitation ip western blot wb applications are based on unconjugated antibody of to hela cell concentration 10 ug ml aaa26410_if aaa26410_if2 m16 clone analysis expression k 562 cat # l009v1 aaa26410_wb3 testing data detection limit for recombinant gst tagged is approximately 0.03ng capture aaa26410_td4 over expressed 293 line cotransfected validated chimera rnai h00mbs6095426 r01v lane 2 or non transfected control 1 probed gapdh 36.1 kda used specificity and loading aaa26410_wb5 293t by lysate 20 aaa26410_wb6 ferritin light polypeptide mgc71996 chain lftd nbia3 13279005 aah04245 p02792 antibodies serum proteins immunogen 1aa 175aa full length protein tag mw the alone 26kd sequence mssqirqnystdveaavnslvnlylqasytylslgfyfdrddvalegvshffrelaeekregyerllkmqnqrggralfqdikkpaedewgktpdamkaamalekklnqalldlhalgsartdphlcdflethfldeevklikkmgdhltnlhrlggpeaglgeylferltlkhd conjugate ph7.2 concentration10 k562 expressed293 lane2 control1 lysate20
IHC (Immunohistchemistry)||Immunohistochemistry of paraffin-embedded mouse brain using ADAR antibody at dilution of 1:100 (40x lens).||AAA28202_IHC9.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded mouse testis using ADAR antibody at dilution of 1:100 (40x lens).||AAA28202_IHC8.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human stomach using ADAR antibody at dilution of 1:100 (40x lens).||AAA28202_IHC7.jpg!!IHC (Immunohistchemistry)||Immunohistochemistry of paraffin-embedded human breast cancer using ADAR antibody at dilution of 1:100 (40x lens).||AAA28202_IHC6.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human liver using ADAR antibody at dilution of 1:100 (40x lens).||AAA28202_IHC5.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded rat heart using ADAR antibody at dilution of 1:100 (40x lens).||AAA28202_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded rat brain using ADAR antibody at dilution of 1:100 (40x lens).||AAA28202_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded rat testis using ADAR antibody at dilution of 1:100 (40x lens).||AAA28202_IHC2.jpg!!WB (Western Blot)||Western blot analysis of extracts of various cell lines, using ADAR antibody at 1:1000 dilution.<br>Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.<br>Lysates/proteins: 25ug per lane.<br>Blocking buffer: 3% nonfat dry milk in TBST.<br>Detection: ECL Enhanced Kit.<br>Exposure time: 20s.||AAA28202_WB.jpg
This gene encodes the enzyme responsible for RNA editing by site-specific deamination of adenosines. This enzyme destabilizes double-stranded RNA through conversion of adenosine to inosine. Mutations in this gene have been associated with dyschromatosis symmetrica hereditaria. Alternative splicing results in multiple transcript variants.
C6 Deamination Of Adenosine Pathway||1269708!!Cytokine Signaling In Immune System Pathway||1269310!!Cytosolic DNA-sensing Pathway||125137!!Cytosolic DNA-sensing Pathway||124833!!Formation Of Editosomes By ADAR Proteins Pathway||1269707!!Gene Expression Pathway||1269649!!Immune System Pathway||1269170!!Influenza A Pathway||217173!!Influenza A Pathway||217150!!Interferon Signaling Pathway||1269311
IHC (Immunohistchemistry)||Immunohistochemistry of paraffin-embedded mouse heart using BAZ1B antibody at dilution of 1:100 (40x lens).||AAA28215_IHC6.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded mouse stomach using BAZ1B antibody at dilution of 1:100 (40x lens).||AAA28215_IHC5.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded mouse brain using BAZ1B antibody at dilution of 1:100 (40x lens).||AAA28215_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded mouse lung using BAZ1B antibody at dilution of 1:100 (40x lens).||AAA28215_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded rat brain using BAZ1B antibody at dilution of 1:100 (40x lens).||AAA28215_IHC2.jpg!!WB (Western Blot)||Western blot analysis of extracts of various cell lines, using BAZ1B antibody at 1:1000 dilution.<br>Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.<br>Lysates/proteins: 25ug per lane.<br>Blocking buffer: 3% nonfat dry milk in TBST.<br>Detection: ECL Basic Kit.<br>Exposure time: 5s.||AAA28215_WB.jpg
⇄etc_term1 => string (45) "Immunogen||Recombinant protein of human BAZ1B"
Bromodomain adjacent to zinc finger domain protein 1B; Williams syndrome transcription factor; Williams-Beuren syndrome chromosomal region 10 protein; Williams-Beuren syndrome chromosomal region 9 protein; hWALp2
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.<br><br>FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (30) "ELISA (EIA), Western Blot (WB)"
WB (Western Blot)||Western Blot analysis of OPA1 expression in transfected 293T cell line by OPA1 monoclonal antibody (M06), clone 8A32.<br><br>Lane 1: OPA1 transfected lysate (Predicted MW: 111.6 KDa).<br>Lane 2: Non-transfected lysate.<br>||AAA26419_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged OPA1 is 0.1 ng/ml as a capture antibody.||AAA26419_APP5.jpg!!WB (Western Blot)||OPA1 monoclonal antibody (M06), clone 8A32. Western Blot analysis of OPA1 expression in rat brain.||AAA26419_WB4.jpg!!WB (Western Blot)||OPA1 monoclonal antibody (M06), clone 8A32. Western Blot analysis of OPA1 expression in human ovarian cancer.||AAA26419_WB3.jpg!!WB (Western Blot)||OPA1 monoclonal antibody (M06), clone 8A32. Western Blot analysis of OPA1 expression in PC-12.||AAA26419_WB2.jpg!!WB (Western Blot)||OPA1 monoclonal antibody (M06), clone 8A32. Western Blot analysis of OPA1 expression in Daoy.||AAA26419_WB.jpg
⇄⧉etc_term1 => string (264) "Immunogen||OPA1 (NP_056375, 851aa-960aa) partial recombinant protein with GS...
Immunogen||OPA1 (NP_056375, 851aa-960aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||NHCNLCRRGFYYYQRHFVDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNVKEVLEDFAEDGEKKIKLLTGKRVQLAEDLKKVREIQEKLDAFIEALHQEK!!Conjugate||FITC
This gene product is a nuclear-encoded mitochondrial protein with similarity to dynamin-related GTPases. It is a component of the mitochondrial network. Mutations in this gene have been associated with optic atrophy type 1, which is a dominantly inherited optic neuropathy resulting in progressive loss of visual acuity, leading in many cases to legal blindness. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
aaa26419 mouse monoclonal igg2a,k 8a32 purified supplied as a liquid in pbs ph 7.2 no preservative added labeled with fluorescein isothiocyanate fitc recognizes opa1 elisa eia western blot wb applications are based on unconjugated antibody m06 clone analysis of expression daoy aaa26419_wb pc 12 aaa26419_wb2 human ovarian cancer aaa26419_wb3 rat brain aaa26419_wb4 testing data detection limit for recombinant gst tagged is 0.1 ng ml capture aaa26419_td5 transfected 293t cell line by lane 1 lysate predicted mw 111.6 kda 2 non aaa26419_wb6 pptic atrophy autosomal dominant flj12460 kiaa0567 mgm1 npg ntg largeg dynamin like 120 protein mitochondrial isoform preproprotein gtpase berhs mtdps14 optic opa1_human 224831243 np_056375 o60313 np_056375.2 125250 antibodies proteins immunogen 851aa 960aa partial tag the alone 26kd sequence nhcnlcrrgfyyyqrhfvdselecndvvlfwriqrmlaitantlrqqltntevrrleknvkevledfaedgekkiklltgkrvqlaedlkkvreiqekldafiealhqek conjugate ph7.2 pc12 is0.1 lane1 kda2 like120
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (58) "ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)"
WB (Western Blot)||SSH3 monoclonal antibody, Western Blot analysis of SSH3 expression in A-431.||AAA24376_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged SSH3 is ~0.3ng/ml as a capture antibody.||AAA24376_APP5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to SSH3 on A-431 cell. [antibody concentration 10ug/ml].||AAA24376_IF4.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to SSH3 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 1-10ug/ml]||AAA24376_IHC3.jpg!!WB (Western Blot)||Western Blot analysis of SSH3 expression in transfected 293T cell line by SSH3 monoclonal antibody. Lane 1: SSH3 transfected lysate (73kD). Lane 2: Non-transfected lysate.||AAA24376_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (37kD).||AAA24376_WB.jpg
⇄⧉etc_term1 => string (268) "Immunogen||Partial recombinant corresponding to aa293-392 from human SSH3 (N...
Immunogen||Partial recombinant corresponding to aa293-392 from human SSH3 (NP_060327) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||SKEIRQALELRLGLPLQQYRDFIDNQMLLLVAQRDRASRIFPHLYLGSEWNAANLEELQRNRVTHILNMAREIDNFYPERFTYHNVRLWDEESAQLLPH!!Conjugate||AP
aaa24376 mouse human monoclonal igg2a,k 6f9 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with alkaline phosphatase ap recognizes ssh3 elisa eia immunohistochemistry ihc western blot wb applications are based on unconjugated antibody detection against immunogen 37kd aaa24376_wb analysis of expression transfected 293t cell line lane 1 lysate 73kd 2 non aaa24376_wb2 immunoperoxidase to formalin fixed paraffin embedded salivary gland concentration 10ug ml aaa24376_ihc3 immunofluorescence if 431 aaa24376_if4 testing data limit for recombinant gst tagged is ~0.3ng capture aaa24376_td5 aaa24376_wb6 slingshot homolog 3 ssh like ssh3l 3l hssh ec=3.1.3.16 ec=3.1.3.48 ssh3_human 239582767 np_060327 q8te77 nm_017857 606780 antibodies actin related proteins partial corresponding aa293 392 from tag mw the alone 26kd sequence skeirqalelrlglplqqyrdfidnqmlllvaqrdrasrifphlylgsewnaanleelqrnrvthilnmareidnfyperftyhnvrlwdeesaqllph conjugate ph7.2 lane1 73kd2 if431 homolog3 aa293392
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (56) "ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)"
WB (Western Blot)||GLMN monoclonal antibody Western Blot analysis of GLMN expression in HL-60.||AAA25407_WB7.jpg!!WB (Western Blot)||GLMN monoclonal antibody Western Blot analysis of GLMN expression in Jurkat.||AAA25407_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged GLMN is ~0.03ng/ml as a capture antibody.||AAA25407_APP5.jpg!!IP (Immunoprecipitation)||Immunoprecipitation of GLMN transfected lysate using GLMN monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GLMN rabbit polyclonal antibody.||AAA25407_IP4.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to GLMN on HeLa cell. [antibody concentration 20ug/ml]||AAA25407_IF3.jpg!!WB (Western Blot)||Western Blot analysis of GLMN expression in transfected 293T cell line by GLMN monoclonal antibody. Lane 1: GLMN transfected lysate (68.2kD). Lane 2: Non-transfected lysate.||AAA25407_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (91.45kD).||AAA25407_WB.jpg
⇄⧉etc_term1 => string (420) "Immunogen||Full length recombinant corresponding to aa1-595 from GLMN (AAH01...
Immunogen||Full length recombinant corresponding to aa1-595 from GLMN (AAH01257) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MAVEELQSIIKRCQILEEQDFKEEDFGLFQLAGQRCIEEGHTDQLLEIIQNEKNKVIIKNMGWNLVGPVVRCLLCKDKEDSKRKVYFLIFDLLVKLCNPKELLLGLLELIEEPSGKQISQSILLLLQPLQTVIQKLHNKAYSIGLALSTLWNQLSLLPVPYSKEQIQMDDYGLCQCCKALIEFTKPFVEEVIDNKENSLENEKLKDELLKFCFKSLKCPLLTAQFFEQSEEGGNDPFRYFASEIIGFLSAIGHPF!!Conjugate||HRP
This gene encodes a phosphorylated protein that is a member of a Skp1-Cullin-F-box-like complex. The protein is essential for normal development of the vasculature and mutations in this gene have been associated with glomuvenous malformations, also called glomangiomas. Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only one has been determined. [provided by RefSeq].
aaa25407 mouse human monoclonal igg1,k 1c12 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with horseradish peroxidase hrp recognizes glmn elisa eia immunoprecipitation ip western blot wb applications are based on unconjugated antibody detection against immunogen 91.45kd aaa25407_wb analysis of expression transfected 293t cell line lane 1 lysate 68.2kd 2 non aaa25407_wb2 immunofluorescence if to hela concentration 20ug ml aaa25407_if3 using and magnetic bead immunoblotted rabbit polyclonal aaa25407_ip4 testing data limit for recombinant gst tagged is ~0.03ng capture aaa25407_td5 jurkat aaa25407_wb6 hl 60 aaa25407_wb7 fap48 fap68 vmglom glomulin fk506 binding associated fap fkbp homo sapiens mrna gvm glml fkbpap 12654828 bc001257 aah01257 q92990 antibodies proteins full length corresponding aa1 595 from tag mw the alone 26kd sequence maveelqsiikrcqileeqdfkeedfglfqlagqrcieeghtdqlleiiqneknkviiknmgwnlvgpvvrcllckdkedskrkvyflifdllvklcnpkelllgllelieepsgkqisqsillllqplqtviqklhnkaysiglalstlwnqlsllpvpyskeqiqmddyglcqcckalieftkpfveevidnkensleneklkdellkfcfkslkcplltaqffeqseeggndpfryfaseiigflsaighpf conjugate ph7.2 lane1 68.2kd2 hl60 aa1595
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
WB (Western Blot)||EHD3 monoclonal antibody. Western Blot analysis of EHD3 expression in COLO 320 HSR.||AAA25674_WB7.jpg!!WB (Western Blot)||EHD3 monoclonal antibody, Western Blot analysis of EHD3 expression in IMR-32.||AAA25674_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged EHD3 is ~0.1ng/ml as a capture antibody.||AAA25674_APP5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to EHD3 on HeLa cell. [antibody concentration 25ug/ml].||AAA25674_IF4.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to EHD3 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3ug/ml].||AAA25674_IHC3.jpg!!WB (Western Blot)||EHD3 monoclonal antibody. Western Blot analysis of EHD3 expression in MCF-7.||AAA25674_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (31.61kD).||AAA25674_WB.jpg
⇄⧉etc_term1 => string (219) "Immunogen||Partial recombinant corresponding to aa357-407 from human EHD3 (N...
Immunogen||Partial recombinant corresponding to aa357-407 from human EHD3 (NP_055415) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||KRMQDQLQAQDFSKFQPLKSKLLEVVDDMLAHDIAQLMVLVRQEESQRPI!!Conjugate||PE
Endocytosis Pathway||102279!!Endocytosis Pathway||102181!!Factors Involved In Megakaryocyte Development And Platelet Production Pathway||1269377!!Hemostasis Pathway||1269340
⇄sp_protein_name => string (30) "EH domain-containing protein 2"
aaa25674 mouse human monoclonal igg1,k 4b7 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with r phycoerythrin pe recognizes ehd3 elisa eia immunofluorescence if immunohistochemistry ihc western blot wb 25ug ml applications are based on unconjugated antibody detection against immunogen 31.61kd aaa25674_wb analysis of expression mcf 7 aaa25674_wb2 immunoperoxidase to formalin fixed paraffin embedded liver concentration 3ug aaa25674_ihc3 hela cell aaa25674_if4 testing data limit for recombinant gst tagged is ~0.1ng capture aaa25674_td5 imr 32 aaa25674_wb6 colo 320 hsr aaa25674_wb7 eh domain containing 3 past homolog ehd2 past3 61 kda 2 2curated ehd2_human 7657056 np_055415 q9nzn3 nm_014600 q8n514 q9nzb3 b4dfr5 d6w574 605890 antibodies transport proteins partial corresponding aa357 407 from tag mw the alone 26kd sequence krmqdqlqaqdfskfqplkskllevvddmlahdiaqlmvlvrqeesqrpi conjugate ph7.2 mcf7 imr32 colo320 containing3 past361 kda2 aa357407
IHC (Immunohistchemistry)||Immunohistochemistry of paraffin-embedded rat kidney using PRDM2 antibody at dilution of 1:100 (40x lens).||AAA28225_IHC6.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded rat brain using PRDM2 antibody at dilution of 1:100 (40x lens).||AAA28225_IHC5.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded rat testis using PRDM2 antibody at dilution of 1:100 (40x lens).||AAA28225_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded rat liver using PRDM2 antibody at dilution of 1:100 (40x lens).||AAA28225_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded rat lung using PRDM2 antibody at dilution of 1:100 (40x lens).||AAA28225_IHC2.jpg!!WB (Western Blot)||Western blot analysis of extracts of rat heart, using PRDM2 antibody at 1:1000 dilution.<br>Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.<br>Lysates/proteins: 25ug per lane.<br>Blocking buffer: 3% nonfat dry milk in TBST.<br>Detection: ECL Basic Kit.<br>Exposure time: 90s.||AAA28225_WB.jpg
⇄etc_term1 => string (45) "Immunogen||Recombinant protein of human PRDM2"
This tumor suppressor gene is a member of a nuclear histone/protein methyltransferase superfamily. It encodes a zinc finger protein that can bind to retinoblastoma protein, estrogen receptor, and the TPA-responsive element (MTE) of the heme-oxygenase-1 gene. Although the functions of this protein have not been fully characterized, it may (1) play a role in transcriptional regulation during neuronal differentiation and pathogenesis of retinoblastoma, (2) act as a transcriptional activator of the heme-oxygenase-1 gene, and (3) be a specific effector of estrogen action. Multiple transcript variants encoding different isoforms have been found for this gene.
IF (Immunofluorescence)||Immunofluorescence analysis of Jurkat cells using CASP3 antibody at dilution of 1:100. Jurkat cells treated by Etoposide 25uM etoposide for 5 hours (left). Blue: DAPI for nuclear staining.||AAA28248_IF6.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human gastric cancer using CASP3 antibody at dilution of 1:100 (40x lens).||AAA28248_IHC5.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human breast cancer using CASP3 antibody at dilution of 1:100 (40x lens).||AAA28248_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded rat brain using CASP3 antibody at dilution of 1:100 (40x lens).||AAA28248_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded rat lung using CASP3 antibody at dilution of 1:100 (40x lens).||AAA28248_IHC2.jpg!!WB (Western Blot)||Western blot analysis of extracts of Jurkat cells, using CASP3 antibody at 1:1000 dilution. Jurkat cells treated by Etoposide 25uM etoposide for 5 hours.<br>Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.<br>Lysates/proteins: 25ug per lane.<br>Blocking buffer: 3% nonfat dry milk in TBST.<br>Detection: ECL Basic Kit.<br>Exposure time: 15s.||AAA28248_WB.jpg
⇄etc_term1 => string (45) "Immunogen||Recombinant protein of human CASP3"
This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 6, 7 and 9, and the protein itself is processed by caspases 8, 9 and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease. Alternative splicing of this gene results in two transcript variants that encode the same protein.
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (70) "Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)"
WB (Western Blot)||SMAD1 monoclonal antibody (M03), clone 2E9. Western Blot analysis of SMAD1 expression in IMR-32 (Cat # L008V1).||AAA26459_WB6.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to SMAD1 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26459_IF5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to SMAD1 on HeLa cell. [antibody concentration 10 ug/ml]||AAA26459_IF4.jpg!!WB (Western Blot)||SMAD1 monoclonal antibody (M03), clone 2E9 Western Blot analysis of SMAD1 expression in HeLa (Cat # L013V1).||AAA26459_WB3.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to SMAD1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]||AAA26459_IHC2.jpg!!Application Data||Immunoperoxidase of monoclonal antibody to SMAD1 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]||AAA26459_APP.jpg
Immunogen||SMAD1 (AAH01878.1, 1aa-465aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQPMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS!!Conjugate||HRP
1. Temporal and regional patterns of Smad activation in the rat hippocampus following global ischemia. Nakajima T, Yanagihara M, Nishii HJ Neurol Sci. 2013 Nov 19. pii: S0022-510X(13)03041-4. doi: 10.1016/j.jns.2013.11. 012.
aaa26459 mouse monoclonal igg1,k 2.0e+9 purified supplied as a liquid in pbs ph 7.2 no preservative added labeled with horseradish peroxidase hrp recognizes smad1 immunofluorescence if immunohistochemistry ihc western blot wb applications are based on unconjugated antibody testing data immunoperoxidase of to formalin fixed paraffin embedded human colon concentration 3 ug ml aaa26459_td aaa26459_ihc2 m03 clone 2e9 analysis expression hela cat # l013v1 aaa26459_wb3 cell 10 aaa26459_if4 aaa26459_if5 imr 32 l008v1 aaa26459_wb6 smad family member 1 bsp1 jv4 jv41 madh1 madr1 bsp mothers against decapentaplegic homolog mad related protein tgf beta signaling dpp transforming growth factor b 52,260 da 12804861 aah01878.1 q15797 q16636 a8kaj0 d3dnz9 antibodies proteins immunogen 1aa 465aa full length recombinant gst tag mw the alone is 26kd sequence mnvtslfsftspavkrllgwkqgdeeekwaekavdalvkklkkkkgameelekalscpgqpsncvtiprsldgrlqvshrkglphviycrvwrwpdlqshhelkpleccefpfgskqkevcinpyhykrvespvlppvlvprhseynpqhsllaqfrnlgqnephmplnatfpdsfqqpnshpfphspnssypnspgsssstyphsptssdpgspfqmpadtpppaylppedpmtqdgsqpmdtnmmapplpseinrgdvqavayeepkhwcsivyyelnnrvgeafhasstsvlvdgftdpsnnknrfclgllsnvnrnstientrrhigkgvhlyyvggevyaeclsdssifvqsrncnyhhgfhpttvckipsgcslkifnnqefaqllaqsvnhgfetvyeltkmctirmsfvkgwgaeyhrqdvtstpcwieihlhgplqwldkvltqmgsphnpissvs conjugate ph7.2 concentration3 clone2e9 cell10 imr32 member1
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
WB (Western Blot)||RASSF8 monoclonal antibody Western Blot analysis of RASSF8 expression in HeLa.||AAA24928_WB7.jpg!!WB (Western Blot)||RASSF8 monoclonal antibody Western Blot analysis of RASSF8 expression in PC-12||AAA24928_WB6.jpg!!IP (Immunoprecipitation)||Immunoprecipitation of RASSF8 transfected lysate using RASSF8 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with RASSF8 rabbit polyclonal antibody.||AAA24928_IP5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to RASSF8 on HeLa cell. [antibody concentration 10ug/ml]||AAA24928_IF4.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to RASSF8 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml]||AAA24928_IHC3.jpg!!WB (Western Blot)||RASSF8 monoclonal antibody Western Blot analysis of RASSF8 expression in NIH/3T3||AAA24928_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (36.52kD).||AAA24928_WB.jpg
⇄⧉etc_term1 => string (266) "Immunogen||Partial recombinant corresponding to aa40-138 from RASSF8 (NP_009...
Immunogen||Partial recombinant corresponding to aa40-138 from RASSF8 (NP_009142) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||YTLIEKWRDTERHLAPHENPIISLNKWGQYASDVQLILRRTGPSLSERPTSDSVARIPERTLYRQSLPPLAKLRPQIDKSIKRREPKRKSLTFTGGAK!!Conjugate||Biotin
aaa24928 mouse human rat monoclonal igg2a,k 2g1 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with biotin recognizes rassf8 species crossreactivity and elisa eia immunofluorescence if immunohistochemistry ihc paraffin immunoprecipitation ip western blot wb p 3ug ml 10ug applications are based on unconjugated antibody detection against immunogen 36.52kd aaa24928_wb analysis of expression nih 3t3 aaa24928_wb2 immunoperoxidase to formalin fixed embedded testis concentration aaa24928_ihc3 hela cell aaa24928_if4 transfected lysate using magnetic bead immunoblotted rabbit polyclonal aaa24928_ip5 pc 12 aaa24928_wb6 aaa24928_wb7 ras association domain containing 8 carcinoma associated hoj 1 c12orf2 isoform family member hoj1 45kda rasf8_human 258613929 np_009142 q8nhq8 nm_007211 608180 antibodies gtpase rab rho proteins partial recombinant corresponding aa40 138 from gst tag mw the alone is 26kd sequence ytliekwrdterhlaphenpiislnkwgqyasdvqlilrrtgpslserptsdsvaripertlyrqslpplaklrpqidksikrrepkrksltftggak conjugate ph7.2 pc12 containing8 aa40138
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
⇄app_tested => string (47) "Western Blot (WB), Immunohistochemistry (IHC-P)"
Reconstitution||Add 0.2ml of distilled water will yield a concentration of 500ug/ml.!!Immunogen||E.coli-derived human IRS1 recombinant protein (Position: S1041-Q1242). Human IRS1 shares 78% and 80% amino acid (aa) sequences identity with mouse and rat IRS1, respectively.
<b>Description: </b>Rabbit IgG polyclonal antibody for Insulin receptor substrate 1(IRS1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.<br><b>Background: </b>Insulin receptor substrate 1(IRS-1) is a signalling adapter protein that in humans is encoded by the IRS-1 gene. It is mapped to 2q36.3. This gene exhibited no intrinsic enzyme activity, and it can serve as a docking protein involved in binding and activating other signal transduction molecules after being phosphorylated on tyrosine by insulin receptor kinase. IRS1 plays a key role in transmitting signals from the insulin and insulin-like growth factor-1(IGF-1) receptors to intracellular pathways PI3K/Akt and Erk MAP kinase pathways. IRS1 also has important biological function for both metabolic and mitogenic(growth promoting) pathways. In addition to those, IRS1 is a key regulator of PI3K within malignant cells.
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
WB (Western Blot)||RPS6KB1 monoclonal antibody (M04), clone 4H4. Western Blot analysis of RPS6KB1 expression in PC-12.||AAA25972_WB6.jpg!!WB (Western Blot)||RPS6KB1 monoclonal antibody (M04), clone 4H4. Western Blot analysis of RPS6KB1 expression in NIH/3T3.||AAA25972_WB5.jpg!!Application Data||Detection limit for recombinant GST tagged RPS6KB1 is approximately 0.1ng/ml as a capture antibody.||AAA25972_APP4.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to RPS6KB1 on HeLa cell. [antibody concentration 10 ug/ml]||AAA25972_IF3.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to RPS6KB1 on HeLa cell. [antibody concentration 10 ug/ml]||AAA25972_IF2.jpg!!WB (Western Blot)||RPS6KB1 monoclonal antibody (M04), clone 4H4 Western Blot analysis of RPS6KB1 expression in HeLa.||AAA25972_WB.jpg
Immunogen||RPS6KB1 (NP_003152, 416aa-525aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||PSVLESVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL!!Conjugate||AP
This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates several residues of the S6 ribosomal protein. The kinase activity of this protein leads to an increase in protein synthesis and cell proliferation. Amplification of the region of DNA encoding this gene and overexpression of this kinase are seen in some breast cancer cell lines. Alternate translational start sites have been described and alternate transcriptional splice variants have been observed but have not been thoroughly characterized. [provided by RefSeq]
aaa25972 mouse monoclonal igg1,k 4h4 purified supplied as a liquid in pbs ph 7.2 no preservative added labeled with alkaline phosphatase ap recognizes rps6kb1 western blot wb applications are based on unconjugated antibody m04 clone analysis of expression hela aaa25972_wb immunofluorescence if to cell concentration 10 ug ml aaa25972_if2 aaa25972_if3 testing data detection limit for recombinant gst tagged is approximately 0.1ng capture aaa25972_td4 nih 3t3 aaa25972_wb5 pc 12 aaa25972_wb6 ribosomal protein s6 kinase 70kd polypeptide 1 ps6k s6k s6k1 stk14a p70 alpha beta isoform b1 s6ka 60.2kda 533aa 70 100kda sds page under reducing conditions kda p70s6k1 i serine threonine 14a ks6b1_human 4506737 np_003152 p23443 nm_003161.3 q7z721 b2r779 b4dlt4 b4dtg1 e7esb8 f6uym1 608938 antibodies proteins immunogen 416aa 525aa partial tag mw the alone 26kd sequence psvlesvkekfsfepkirsprrfigsprtpvspvkfspgdfwgrgasastanpqtpveypmetsgieqmdvtmsgeasaplpirqpnsgpykkqafpmiskrpehlrmnl conjugate ph7.2 concentration10 pc12 polypeptide1 533aa70
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Application Data||Detection limit for recombinant GST tagged SNRPA is ~0.03ng/ml as a capture antibody.||AAA24961_APP6.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to SNRPA on HeLa cell. [antibody concentration 10ug/ml].||AAA24961_IF5.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to SNRPA on formalin-fixed paraffin-embedded human heart tissue. [antibody concentration 3ug/ml].||AAA24961_IHC4.jpg!!WB (Western Blot)||Western Blot analysis of SNRPA expression in transfected 293T cell line by SNRPA monoclonal antibody. Lane 1: SNRPA transfected lysate (31.3kD). Lane 2: Non-transfected lysate.||AAA24961_WB3.jpg!!WB (Western Blot)||SNRPA monoclonal antibody, Western Blot analysis of SNRPA expression in Hela.||AAA24961_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (57.13kD).||AAA24961_WB.jpg
⇄⧉etc_term1 => string (457) "Immunogen||Full length recombinant corresponding to aa1-283 from human SNRPA...
Immunogen||Full length recombinant corresponding to aa1-283 from human SNRPA (AAH00405) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGTFVERDRKREKRKPKSQETPATKKAVQGGGATPVVGAVQGPVPGMPPMTQAPRIMHHMPGQPPYMPPPGMIPPPGLAPGQIPPGAMPPQQLMPGQMPPAQPLSENPPNHILFLTNLPEETNELMLSMLFNQFPGFKEVRLVPGRHDIAFVEFDNEVQAGAARDALQGFKITQNNAMKISFAKK!!Conjugate||Biotin
aaa24961 mouse human monoclonal igg1,k 3f9 1f7 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with biotin recognizes snrpa elisa eia immunofluorescence if immunohistochemistry ihc western blot wb 10ug ml applications are based on unconjugated antibody detection against immunogen 57.13kd aaa24961_wb analysis of expression hela aaa24961_wb2 transfected 293t cell line lane 1 lysate 31.3kd 2 non aaa24961_wb3 immunoperoxidase to formalin fixed paraffin embedded heart tissue concentration 3ug aaa24961_ihc4 aaa24961_if5 testing data limit for recombinant gst tagged is ~0.03ng capture aaa24961_td6 u1 small nuclear ribonucleoprotein snrnp u1a homo sapiens polypeptide mrna mud1 31,280 da snrpa_human 38197143 bc000405 aah00405 p09012 182285 antibodies proteins full length corresponding aa1 283 from tag mw the alone 26kd sequence mavpetrpnhtiyinnlnekikkdelkkslyaifsqfgqildilvsrslkmrgqafvifkevssatnalrsmqgfpfydkpmriqyaktdsdiiakmkgtfverdrkrekrkpksqetpatkkavqgggatpvvgavqgpvpgmppmtqaprimhhmpgqppympppgmipppglapgqippgamppqqlmpgqmppaqplsenppnhilfltnlpeetnelmlsmlfnqfpgfkevrlvpgrhdiafvefdnevqagaardalqgfkitqnnamkisfakk conjugate ph7.2 lane1 31.3kd2 aa1283
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
WB (Western Blot)||SSH3 monoclonal antibody, Western Blot analysis of SSH3 expression in A-431.||AAA24968_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged SSH3 is ~0.3ng/ml as a capture antibody.||AAA24968_APP5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to SSH3 on A-431 cell. [antibody concentration 10ug/ml].||AAA24968_IF4.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to SSH3 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 1-10ug/ml]||AAA24968_IHC3.jpg!!WB (Western Blot)||Western Blot analysis of SSH3 expression in transfected 293T cell line by SSH3 monoclonal antibody. Lane 1: SSH3 transfected lysate (73kD). Lane 2: Non-transfected lysate.||AAA24968_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (37kD).||AAA24968_WB.jpg
⇄⧉etc_term1 => string (272) "Immunogen||Partial recombinant corresponding to aa293-392 from human SSH3 (N...
Immunogen||Partial recombinant corresponding to aa293-392 from human SSH3 (NP_060327) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||SKEIRQALELRLGLPLQQYRDFIDNQMLLLVAQRDRASRIFPHLYLGSEWNAANLEELQRNRVTHILNMAREIDNFYPERFTYHNVRLWDEESAQLLPH!!Conjugate||Biotin
aaa24968 mouse human monoclonal igg2a,k 6f9 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with biotin recognizes ssh3 elisa eia immunofluorescence if immunohistochemistry ihc western blot wb 10ug ml applications are based on unconjugated antibody detection against immunogen 37kd aaa24968_wb analysis of expression transfected 293t cell line lane 1 lysate 73kd 2 non aaa24968_wb2 immunoperoxidase to formalin fixed paraffin embedded salivary gland concentration aaa24968_ihc3 431 aaa24968_if4 testing data limit for recombinant gst tagged is ~0.3ng capture aaa24968_td5 aaa24968_wb6 phosphatase slingshot homolog 3 ssh like ssh3l 3l hssh ec=3.1.3.16 ec=3.1.3.48 ssh3_human 239582767 np_060327 q8te77 nm_017857 606780 antibodies actin related proteins partial corresponding aa293 392 from tag mw the alone 26kd sequence skeirqalelrlglplqqyrdfidnqmlllvaqrdrasrifphlylgsewnaanleelqrnrvthilnmareidnfyperftyhnvrlwdeesaqllph conjugate ph7.2 lane1 73kd2 aaa24968_ihc3431 homolog3 aa293392
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (56) "ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)"
WB (Western Blot)||GLMN monoclonal antibody Western Blot analysis of GLMN expression in HL-60.||AAA24225_WB7.jpg!!WB (Western Blot)||GLMN monoclonal antibody Western Blot analysis of GLMN expression in Jurkat.||AAA24225_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged GLMN is ~0.03ng/ml as a capture antibody.||AAA24225_APP5.jpg!!IP (Immunoprecipitation)||Immunoprecipitation of GLMN transfected lysate using GLMN monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GLMN rabbit polyclonal antibody.||AAA24225_IP4.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to GLMN on HeLa cell. [antibody concentration 20ug/ml]||AAA24225_IF3.jpg!!WB (Western Blot)||Western Blot analysis of GLMN expression in transfected 293T cell line by GLMN monoclonal antibody. Lane 1: GLMN transfected lysate (68.2kD). Lane 2: Non-transfected lysate.||AAA24225_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (91.45kD).||AAA24225_WB.jpg
⇄⧉etc_term1 => string (419) "Immunogen||Full length recombinant corresponding to aa1-595 from GLMN (AAH01...
Immunogen||Full length recombinant corresponding to aa1-595 from GLMN (AAH01257) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MAVEELQSIIKRCQILEEQDFKEEDFGLFQLAGQRCIEEGHTDQLLEIIQNEKNKVIIKNMGWNLVGPVVRCLLCKDKEDSKRKVYFLIFDLLVKLCNPKELLLGLLELIEEPSGKQISQSILLLLQPLQTVIQKLHNKAYSIGLALSTLWNQLSLLPVPYSKEQIQMDDYGLCQCCKALIEFTKPFVEEVIDNKENSLENEKLKDELLKFCFKSLKCPLLTAQFFEQSEEGGNDPFRYFASEIIGFLSAIGHPF!!Conjugate||AP
aaa24225 mouse human monoclonal igg1,k 1c12 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with alkaline phosphatase ap recognizes glmn elisa eia immunoprecipitation ip western blot wb applications are based on unconjugated antibody detection against immunogen 91.45kd aaa24225_wb analysis of expression transfected 293t cell line lane 1 lysate 68.2kd 2 non aaa24225_wb2 immunofluorescence if to hela concentration 20ug ml aaa24225_if3 using and magnetic bead immunoblotted rabbit polyclonal aaa24225_ip4 testing data limit for recombinant gst tagged is ~0.03ng capture aaa24225_td5 jurkat aaa24225_wb6 hl 60 aaa24225_wb7 fap48 fap68 vmglom glomulin fk506 binding associated fap fkbp homo sapiens mrna gvm glml fkbpap 12654828 bc001257 aah01257 q92990 antibodies proteins full length corresponding aa1 595 from tag mw the alone 26kd sequence maveelqsiikrcqileeqdfkeedfglfqlagqrcieeghtdqlleiiqneknkviiknmgwnlvgpvvrcllckdkedskrkvyflifdllvklcnpkelllgllelieepsgkqisqsillllqplqtviqklhnkaysiglalstlwnqlsllpvpyskeqiqmddyglcqcckalieftkpfveevidnkensleneklkdellkfcfkslkcplltaqffeqseeggndpfryfaseiigflsaighpf conjugate ph7.2 lane1 68.2kd2 hl60 aa1595
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
WB (Western Blot)||EHD3 monoclonal antibody. Western Blot analysis of EHD3 expression in COLO 320 HSR.||AAA24493_WB7.jpg!!WB (Western Blot)||EHD3 monoclonal antibody, Western Blot analysis of EHD3 expression in IMR-32.||AAA24493_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged EHD3 is ~0.1ng/ml as a capture antibody.||AAA24493_APP5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to EHD3 on HeLa cell. [antibody concentration 25ug/ml].||AAA24493_IF4.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to EHD3 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3ug/ml].||AAA24493_IHC3.jpg!!WB (Western Blot)||EHD3 monoclonal antibody. Western Blot analysis of EHD3 expression in MCF-7.||AAA24493_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (31.61kD).||AAA24493_WB.jpg
⇄⧉etc_term1 => string (220) "Immunogen||Partial recombinant corresponding to aa357-407 from human EHD3 (N...
Immunogen||Partial recombinant corresponding to aa357-407 from human EHD3 (NP_055415) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||KRMQDQLQAQDFSKFQPLKSKLLEVVDDMLAHDIAQLMVLVRQEESQRPI!!Conjugate||APC
Endocytosis Pathway||102279!!Endocytosis Pathway||102181!!Factors Involved In Megakaryocyte Development And Platelet Production Pathway||1269377!!Hemostasis Pathway||1269340
⇄sp_protein_name => string (30) "EH domain-containing protein 2"
aaa24493 mouse human monoclonal igg1,k 4b7 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with allophycocyanin apc recognizes ehd3 elisa eia immunofluorescence if immunohistochemistry ihc western blot wb 25ug ml applications are based on unconjugated antibody detection against immunogen 31.61kd aaa24493_wb analysis of expression mcf 7 aaa24493_wb2 immunoperoxidase to formalin fixed paraffin embedded liver concentration 3ug aaa24493_ihc3 hela cell aaa24493_if4 testing data limit for recombinant gst tagged is ~0.1ng capture aaa24493_td5 imr 32 aaa24493_wb6 colo 320 hsr aaa24493_wb7 eh domain containing 3 past homolog ehd2 past3 61 kda 2 2curated ehd2_human 7657056 np_055415 q9nzn3 nm_014600 q8n514 q9nzb3 b4dfr5 d6w574 605890 antibodies transport proteins partial corresponding aa357 407 from tag mw the alone 26kd sequence krmqdqlqaqdfskfqplkskllevvddmlahdiaqlmvlvrqeesqrpi conjugate ph7.2 mcf7 imr32 colo320 containing3 past361 kda2 aa357407
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
WB (Western Blot)||Western Blot analysis of AFP expression in transfected 293T cell line by AFP monoclonal antibody. Lane 1: AFP transfected lysate (69kD). Lane 2: Non-transfected lysate.||AAA25013_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged AFP is ~0.03ng/ml as a capture antibody.||AAA25013_APP5.jpg!!IP (Immunoprecipitation)||Immunoprecipitation of AFP transfected lysate using AFP monoclonal antibody and Protein A Magnetic Bead and immunoblotted with AFP rabbit polyclonal antibody.||AAA25013_IP4.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to AFP on HepG2 cell. [antibody concentration 30ug/ml].||AAA25013_IF3.jpg!!WB (Western Blot)||AFP monoclonal antibody Western Blot analysis of AFP expression in HepG2.||AAA25013_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (37.84kD).||AAA25013_WB.jpg
⇄⧉etc_term1 => string (279) "Immunogen||Partial recombinant corresponding to aa500-609 from human AFP (AA...
Immunogen||Partial recombinant corresponding to aa500-609 from human AFP (AAH27881) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||CCTSSYANRRPCFSSLVVDETYVPPAFSDDKFIFHKDLCQAQGVALQTMKQEFLINLVKQKPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV!!Conjugate||FITC
1. Immunodevice for simultaneous detection of two relevant tumor markers based on separation of different microparticles by dielectrophoresis. Ramon-Azcon J, Yasukawa T, Mizutani F.Biosens Bioelectron. 2011 Aug 4.
aaa25013 mouse human monoclonal igg 1g7 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with fluorescein isothiocyanate fitc recognizes afp elisa eia immunofluorescence if immunoprecipitation ip western blot wb 30ug ml applications are based on unconjugated antibody detection against immunogen 37.84kd aaa25013_wb analysis of expression hepg2 aaa25013_wb2 to cell concentration aaa25013_if3 transfected lysate using and magnetic bead immunoblotted rabbit polyclonal aaa25013_ip4 testing data limit for recombinant gst tagged is ~0.03ng capture aaa25013_td5 293t line lane 1 69kd 2 non aaa25013_wb6 fetoprotein alpha alpha1 fetoglobulin precursor feta hpafp homo sapiens mrna afpd 68,678 da feta_human 20379786 bc027881 aah27881 p02771 b2rbu3 104150 antibodies serum proteins partial corresponding aa500 609 from tag mw the alone 26kd sequence cctssyanrrpcfsslvvdetyvppafsddkfifhkdlcqaqgvalqtmkqeflinlvkqkpqiteeqleaviadfsgllekccqgqeqevcfaeegqklisktraalgv conjugate ph7.2 lane1 69kd2 aa500609
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
WB (Western Blot)||SSH3 monoclonal antibody, Western Blot analysis of SSH3 expression in A-431.||AAA25264_WB6.jpg!!Application Data||Detection limit for recombinant GST tagged SSH3 is ~0.3ng/ml as a capture antibody.||AAA25264_APP5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to SSH3 on A-431 cell. [antibody concentration 10ug/ml].||AAA25264_IF4.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to SSH3 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 1-10ug/ml]||AAA25264_IHC3.jpg!!WB (Western Blot)||Western Blot analysis of SSH3 expression in transfected 293T cell line by SSH3 monoclonal antibody. Lane 1: SSH3 transfected lysate (73kD). Lane 2: Non-transfected lysate.||AAA25264_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (37kD).||AAA25264_WB.jpg
⇄⧉etc_term1 => string (270) "Immunogen||Partial recombinant corresponding to aa293-392 from human SSH3 (N...
Immunogen||Partial recombinant corresponding to aa293-392 from human SSH3 (NP_060327) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||SKEIRQALELRLGLPLQQYRDFIDNQMLLLVAQRDRASRIFPHLYLGSEWNAANLEELQRNRVTHILNMAREIDNFYPERFTYHNVRLWDEESAQLLPH!!Conjugate||FITC
aaa25264 mouse human monoclonal igg2a,k 6f9 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with fluorescein isothiocyanate fitc recognizes ssh3 elisa eia immunofluorescence if immunohistochemistry ihc western blot wb 10ug ml applications are based on unconjugated antibody detection against immunogen 37kd aaa25264_wb analysis of expression transfected 293t cell line lane 1 lysate 73kd 2 non aaa25264_wb2 immunoperoxidase to formalin fixed paraffin embedded salivary gland concentration aaa25264_ihc3 431 aaa25264_if4 testing data limit for recombinant gst tagged is ~0.3ng capture aaa25264_td5 aaa25264_wb6 phosphatase slingshot homolog 3 ssh like ssh3l 3l hssh ec=3.1.3.16 ec=3.1.3.48 ssh3_human 239582767 np_060327 q8te77 nm_017857 606780 antibodies actin related proteins partial corresponding aa293 392 from tag mw the alone 26kd sequence skeirqalelrlglplqqyrdfidnqmlllvaqrdrasrifphlylgsewnaanleelqrnrvthilnmareidnfyperftyhnvrlwdeesaqllph conjugate ph7.2 lane1 73kd2 aaa25264_ihc3431 homolog3 aa293392
IF (Immunofluorescence)||Immunofluorescence analysis of MCF-7 cells using GAB1 antibody. Blue: DAPI for nuclear staining.||AAA28080_IF7.jpg!!IHC (Immunohistchemistry)||Immunohistochemistry of paraffin-embedded mouse spinal cord using GAB1 antibody at dilution of 1:100 (40x lens).||AAA28080_IHC6.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human gastric cancer using GAB1 antibody at dilution of 1:100 (40x lens).||AAA28080_IHC5.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human colon carcinoma using GAB1 antibody at dilution of 1:100 (40x lens).||AAA28080_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human lung cancer using GAB1 antibody at dilution of 1:100 (40x lens).||AAA28080_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded rat brain using GAB1 antibody at dilution of 1:100 (40x lens).||AAA28080_IHC2.jpg!!WB (Western Blot)||Western blot analysis of extracts of various cell lines, using GAB1 antibody at 1:1000 dilution.<br>Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.<br>Lysates/proteins: 25ug per lane.<br>Blocking buffer: 3% nonfat dry milk in TBST.<br>Detection: ECL Basic Kit.<br>Exposure time: 80s.||AAA28080_WB.jpg
The protein encoded by this gene is a member of the IRS1-like multisubstrate docking protein family. It is an important mediator of branching tubulogenesis and plays a central role in cellular growth response, transformation and apoptosis. Two transcript variants encoding different isoforms have been found for this gene.
Adaptive Immune System Pathway||366160!!B Cell Receptor Signaling Pathway||198909!!Bacterial Invasion Of Epithelial Cells Pathway||149807!!Bacterial Invasion Of Epithelial Cells Pathway||148661!!Constitutive PI3K/AKT Signaling In Cancer Pathway||685535!!Constitutive Signaling By EGFRvIII Pathway||1127578!!Constitutive Signaling By Ligand-Responsive EGFR Cancer Variants Pathway||530769!!DAP12 Interactions Pathway||685549!!DAP12 Signaling Pathway||685550!!Disease Pathway||530764
⇄sp_protein_name => string (33) "GRB2-associated-binding protein 1"
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (68) "Immunofluorescence (IF), Immunoprecipitation (IP), Western Blot (WB)"
WB (Western Blot)||Western Blot analysis of FTL expression in transfected 293T cell line by FTL monoclonal antibody (M18), clone X3.<br><br>Lane 1: FTL transfected lysate (20 KDa).<br>Lane 2: Non-transfected lysate.||AAA26546_WB6.jpg!!WB (Western Blot)||Western blot analysis of FTL over-expressed 293 cell line, cotransfected with FTL Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with FTL monoclonal antibody (M18), clone X3. GAPDH (36.1 kDa) used as specificity and loading control.||AAA26546_WB5.jpg!!Application Data||Detection limit for recombinant GST tagged FTL is approximately 0.03ng/ml as a capture antibody.||AAA26546_APP4.jpg!!WB (Western Blot)||FTL monoclonal antibody (M18), clone X3 Western Blot analysis of FTL expression in K-562 (Cat # L009V1).||AAA26546_WB3.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to FTL on HeLa cell. [antibody concentration 10 ug/ml]||AAA26546_IF2.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to FTL on HeLa cell. [antibody concentration 10 ug/ml]||AAA26546_IF.jpg
⇄⧉etc_term1 => string (328) "Immunogen||FTL (AAH04245, 1aa-175aa) full-length recombinant protein with GS...
Immunogen||FTL (AAH04245, 1aa-175aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MSSQIRQNYSTDVEAAVNSLVNLYLQASYTYLSLGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRGGRALFQDIKKPAEDEWGKTPDAMKAAMALEKKLNQALLDLHALGSARTDPHLCDFLETHFLDEEVKLIKKMGDHLTNLHRLGGPEAGLGEYLFERLTLKHD!!Conjugate||HRP
aaa26546 mouse monoclonal igg1,k x3 purified supplied as a liquid in pbs ph 7.2 no preservative added labeled with horseradish peroxidase hrp recognizes ftl immunofluorescence if immunoprecipitation ip western blot wb applications are based on unconjugated antibody of to hela cell concentration 10 ug ml aaa26546_if aaa26546_if2 m18 clone analysis expression k 562 cat # l009v1 aaa26546_wb3 testing data detection limit for recombinant gst tagged is approximately 0.03ng capture aaa26546_td4 over expressed 293 line cotransfected validated chimera rnai h00mbs6095426 r01v lane 2 or non transfected control 1 probed gapdh 36.1 kda used specificity and loading aaa26546_wb5 293t by lysate 20 aaa26546_wb6 ferritin light polypeptide mgc71996 chain lftd nbia3 13279005 aah04245 p02792 antibodies serum proteins immunogen 1aa 175aa full length protein tag mw the alone 26kd sequence mssqirqnystdveaavnslvnlylqasytylslgfyfdrddvalegvshffrelaeekregyerllkmqnqrggralfqdikkpaedewgktpdamkaamalekklnqalldlhalgsartdphlcdflethfldeevklikkmgdhltnlhrlggpeaglgeylferltlkhd conjugate ph7.2 concentration10 k562 expressed293 lane2 control1 lysate20
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Application Data||Detection limit for recombinant GST tagged PCNA is ~0.1ng/ml as a capture antibody.||AAA25783_APP6.jpg!!IP (Immunoprecipitation)||Immunoprecipitation of PCNA transfected lysate using PCNA monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PCNA rabbit polyclonal antibody||AAA25783_IP5.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to PCNA on HeLa cell. [antibody concentration 10ug/ml]||AAA25783_IF4.jpg!!WB (Western Blot)||Western Blot analysis of PCNA expression in transfected 293T cell line by PCNA monoclonal antibody Lane 1: PCNA transfected lysate (28.8kD). Lane 2: Non-transfected lysate.||AAA25783_WB3.jpg!!WB (Western Blot)||PCNA monoclonal antibody Western Blot analysis of PCNA expression in Hela.||AAA25783_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (54.45kD).||AAA25783_WB.jpg
⇄⧉etc_term1 => string (431) "Immunogen||Full length recombinant corresponding to aa1-262 from human PCNA ...
Immunogen||Full length recombinant corresponding to aa1-262 from human PCNA (AAH00491) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS!!Conjugate||PE
aaa25783 mouse human monoclonal igg2a,k 1g7 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with r phycoerythrin pe recognizes pcna elisa eia immunofluorescence if immunoprecipitation ip western blot wb 10ug ml applications are based on unconjugated antibody detection against immunogen 54.45kd aaa25783_wb analysis of expression hela aaa25783_wb2 transfected 293t cell line lane 1 lysate 28.8kd 2 non aaa25783_wb3 to concentration aaa25783_if4 using and magnetic bead immunoblotted rabbit polyclonal aaa25783_ip5 testing data limit for recombinant gst tagged is ~0.1ng capture aaa25783_td6 proliferating nuclear antigen cyclin mgc8367 homo sapiens mrna atld2 28,769 da 33990414 bc000491 aah00491 p12004 b2r897 d3dw02 antibodies proteins full length corresponding aa1 262 from tag mw the alone 26kd sequence mfearlvqgsilkkvlealkdlineacwdisssgvnlqsmdsshvslvqltlrsegfdtyrcdrnlamgvnltsmskilkcagnediitlraednadtlalvfeapnqekvsdyemklmdldveqlgipeqeyscvvkmpsgefaricrdlshigdavviscakdgvkfsasgelgngniklsqtsnvdkeeeavtiemnepvqltfalrylnfftkatplsstvtlsmsadvplvveykiadmghlkyylapkiedeegs conjugate ph7.2 lane1 28.8kd2 aa1262
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (30) "ELISA (EIA), Western Blot (WB)"
Application Data||Detection limit for recombinant GST tagged S100A4 is ~0.1ng/ml as a capture antibody.||AAA25532_APP6.jpg!!IF (Immunofluorescence)||Immunofluorescence of monoclonal antibody to S100A4 on HeLa cell. [antibody concentration 15ug/ml]||AAA25532_IF5.jpg!!WB (Western Blot)||Western Blot analysis of S100A4 expression in transfected 293T cell line by S100A4 monoclonal antibody. Lane 1: S100A4 transfected lysate (11.7kD). Lane 2: Non-transfected lysate.||AAA25532_WB4.jpg!!WB (Western Blot)||S100A4 monoclonal antibody Western Blot analysis of S100A4 expression in NIH/3T3.||AAA25532_WB3.jpg!!WB (Western Blot)||S100A4 monoclonal antibody Western Blot analysis of S100A4 expression in Hela.||AAA25532_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (37.22kD)||AAA25532_WB.jpg
⇄⧉etc_term1 => string (275) "Immunogen||Full length recombinant corresponding to aa1-102 from human S100A...
Immunogen||Full length recombinant corresponding to aa1-102 from human S100A4 (AAH16300) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCDEFFEGFPDKQPRKK*!!Conjugate||HRP
S100 calcium binding protein A4 (S100A4) is a member of the S100 family of calcium-binding proteins that contain two Ca(2+)-binding sites including a canonical EF-hand motif. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells. S100A4 interacts with cytoskeletal proteins and enhances metastasis of several types of cancer cells. It is secreted by unknown mechanisms, thus, paracrinely stimulating a variety of cellular responses, including angiogenesis and neuronal growth. S100A4 has been shown to be a prognostic marker in a number of human cancers, including esophageal-squamous cancers, non-small lung cancers, primary gastric cancers, malignant melanomas, prostate cancers, bladder cancers, and pancreatic carcinomas. The universality of S100A4 expression in a variety of cancers illustrates the potential use of S100A4 as a marker for tumor metastasis and disease progression.
⇄⧉products_references => string (260) "1. Potential role for S100A4 in the disruption of the blood-brain barrier in...
1. Potential role for S100A4 in the disruption of the blood-brain barrier in collagen-induced arthritic mice, an animal model of rheumatoid arthritis. Nishioku T, Furusho K, Tomita A, Ohishi H, Dohgu S, Shuto H, Yamauchi A, Kataoka Y.Neuroscience. 2011 May 26.
aaa25532 mouse human monoclonal igg1,k 1f12 1g7 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with horseradish peroxidase hrp recognizes s100a4 species crossreactivity elisa eia western blot wb applications are based on unconjugated antibody detection against immunogen 37.22kd aaa25532_wb analysis of expression hela aaa25532_wb2 nih 3t3 aaa25532_wb3 transfected 293t cell line lane 1 lysate 11.7kd 2 non aaa25532_wb4 immunofluorescence if to concentration 15ug ml aaa25532_if5 testing data limit for recombinant gst tagged is ~0.1ng capture aaa25532_td6 s100 a4 calvasculin metastasin placental calcium binding mts1 capl homo sapiens mrna 42a 18a2 fsp1 p9ka pel98 11,729 da 16740880 bc016300 aah16300 p26447 q6icp8 a8k7r8 d3dv46 antibodies proteins full length corresponding aa1 102 from tag mw the alone 26kd sequence macplekaldvmvstfhkysgkegdkfklnkselkelltrelpsflgkrtdeaafqklmsnldsnrdnevdfqeycvflsciammcdeffegfpdkqprkk* conjugate ph7.2 lane1 11.7kd2 aa1102
IHC (Immunohistchemistry)||Immunohistochemistry of paraffin-embedded mouse kidney using TAPBP Antibody at dilution of 1:200 (40x lens).||AAA28097_IHC6.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded mouse testis using TAPBP Antibody at dilution of 1:200 (40x lens).||AAA28097_IHC5.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human gastric cancer using TAPBP Antibody at dilution of 1:200 (40x lens).||AAA28097_IHC4.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded rat testis using TAPBP Antibody at dilution of 1:200 (40x lens).||AAA28097_IHC3.jpg!!IHC (Immunohistochemistry)||Immunohistochemistry of paraffin-embedded human stomach using TAPBP Antibody at dilution of 1:200 (40x lens).||AAA28097_IHC2.jpg!!WB (Western Blot)||Western blot analysis of extracts of HT-29 cells, using TAPBP antibody at 1:1000 dilution.<br>Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.<br>Lysates/proteins: 25ug per lane.<br>Blocking buffer: 3% nonfat dry milk in TBST.<br>Detection: ECL Basic Kit.<br>Exposure time: 90s.||AAA28097_WB.jpg
⇄⧉etc_term1 => string (101) "Species||Human!!Category||Primary antibody!!Buffer||PBS with 0.02% sodium az...
This gene encodes a transmembrane glycoprotein which mediates interaction between newly assembled major histocompatibility complex (MHC) class I molecules and the transporter associated with antigen processing (TAP), which is required for the transport of antigenic peptides across the endoplasmic reticulum membrane. This interaction is essential for optimal peptide loading on the MHC class I molecule. Up to four complexes of MHC class I and this protein may be bound to a single TAP molecule. This protein contains a C-terminal double-lysine motif (KKKAE) known to maintain membrane proteins in the endoplasmic reticulum. This gene lies within the major histocompatibility complex on chromosome 6. Alternative splicing results in three transcript variants encoding different isoforms.
Adaptive Immune System Pathway||366160!!Antigen Presentation: Folding, Assembly And Peptide Loading Of Class I MHC Pathway||366163!!Antigen Processing And Presentation Pathway||83074!!Antigen Processing And Presentation Pathway||485!!Antigen Processing-Cross Presentation Pathway||477122!!Class I MHC Mediated Antigen Processing & Presentation Pathway||366161!!ER-Phagosome Pathway||477124!!Immune System Pathway||106386
Western Blot (WB), Immunohistochemistry-Paraffin (IHC-P), Immunocytochemistry (ICC), Immunofluorescence (IF), Flow Cytometry (FC/FACS/FCM), Direct ELISA (EIA)
