Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using DDX24 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)

Rabbit anti-Human DDX24 Polyclonal Antibody | anti-DDX24 antibody

DDX24 Polyclonal Antibody

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
DDX24; Polyclonal Antibody; DDX24 Polyclonal Antibody; anti-DDX24 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
LTLVHQAPARILHKKHTKKMDKTAKLDLLMQKIGMRGKPKVIDLTRNEATVETLTETKIHCETDEKDFYLYYFLMQYPGRSLVFANSISCIKRLSGLLKVLDIMPLTLHACMHQKQRLRNLEQFARLEDCVLLATDVAARGLDIPKVQHVIHYQVPRTSEIYVHRSGRTARATNEGLSLMLIGPEDVINFKKIYKTLKKDEDIPLFPVQTKYMDVVKERIRLARQIEKSEYRNFQACLHNSWIEQAAAALEIELE
Sequence Length
859
Applicable Applications for anti-DDX24 antibody
Western Blot (WB)
Application Notes
WB: 1:200 - 1:2000
Immunogen
Recombinant protein of human DDX24
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Positive Samples
HT-29, LO2, Jurkat, HeLa
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using DDX24 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using DDX24 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Related Product Information for anti-DDX24 antibody
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which shows little similarity to any of the other known human DEAD box proteins, but shows a high similarity to mouse Ddx24 at the amino acid level.
Product Categories/Family for anti-DDX24 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 90kDa; 96kDa
Observed: 120kDa
NCBI Official Full Name
ATP-dependent RNA helicase DDX24
NCBI Official Synonym Full Names
DEAD-box helicase 24
NCBI Official Symbol
DDX24
NCBI Protein Information
ATP-dependent RNA helicase DDX24
UniProt Protein Name
ATP-dependent RNA helicase DDX24
UniProt Gene Name
DDX24

NCBI Description

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which shows little similarity to any of the other known human DEAD box proteins, but shows a high similarity to mouse Ddx24 at the amino acid level. [provided by RefSeq, Jul 2008]

Uniprot Description

ATP-dependent RNA helicase.

Research Articles on DDX24

Similar Products

Product Notes

The DDX24 ddx24 (Catalog #AAA9135467) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DDX24 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DDX24 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:200 - 1:2000. Researchers should empirically determine the suitability of the DDX24 ddx24 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LTLVHQAPAR ILHKKHTKKM DKTAKLDLLM QKIGMRGKPK VIDLTRNEAT VETLTETKIH CETDEKDFYL YYFLMQYPGR SLVFANSISC IKRLSGLLKV LDIMPLTLHA CMHQKQRLRN LEQFARLEDC VLLATDVAAR GLDIPKVQHV IHYQVPRTSE IYVHRSGRTA RATNEGLSLM LIGPEDVINF KKIYKTLKKD EDIPLFPVQT KYMDVVKERI RLARQIEKSE YRNFQACLHN SWIEQAAAAL EIELE. It is sometimes possible for the material contained within the vial of "DDX24, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.