Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of DDIT4L expression in transfected 293T cell line by DDIT4L polyclonal antibody. Lane 1: DDIT4L transfected lysate (21.7kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human DDIT4L Polyclonal Antibody | anti-DDIT4L antibody

DDIT4L (REDD2, RTP801L, DNA Damage-inducible Transcript 4-like Protein, HIF-1 Responsive Protein RTP801-like, Protein Regulated in Development and DNA Damage Response 2) (Biotin)

Gene Names
DDIT4L; REDD2; Rtp801L
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DDIT4L; Polyclonal Antibody; DDIT4L (REDD2; RTP801L; DNA Damage-inducible Transcript 4-like Protein; HIF-1 Responsive Protein RTP801-like; Protein Regulated in Development and DNA Damage Response 2) (Biotin); anti-DDIT4L antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human DDIT4L.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-DDIT4L antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human DDIT4L, aa1-193 (NP_660287.1).
Immunogen Sequence
MVATGSLSSKNPASISELLDCGYHPESLLSDFDYWDYVVPEPNLNEVIFEESTCQNLVKMLENCLSKSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKLDRIVCDSSVVPTFELTLVFKQENCSWTSFRDFFFSRGRFSSGFRRTLILSSGFRLVKKKLYSLIGTTVIEGS
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of DDIT4L expression in transfected 293T cell line by DDIT4L polyclonal antibody. Lane 1: DDIT4L transfected lysate (21.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of DDIT4L expression in transfected 293T cell line by DDIT4L polyclonal antibody. Lane 1: DDIT4L transfected lysate (21.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-DDIT4L antibody
DDIT4L inhibits cell growth by regulating the FRAP1 pathway upstream of the TSC1-TSC2 complex and downstream of AKT1.
Product Categories/Family for anti-DDIT4L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21,740 Da
NCBI Official Full Name
DNA damage-inducible transcript 4-like protein
NCBI Official Synonym Full Names
DNA-damage-inducible transcript 4-like
NCBI Official Symbol
DDIT4L
NCBI Official Synonym Symbols
REDD2; Rtp801L
NCBI Protein Information
DNA damage-inducible transcript 4-like protein; REDD-2; homolog of mouse SMHS1; HIF-1 responsive protein RTP801-like; regulated in development and DNA damage response 2; protein regulated in development and DNA damage response 2
UniProt Protein Name
DNA damage-inducible transcript 4-like protein
UniProt Gene Name
DDIT4L
UniProt Synonym Gene Names
REDD2; RTP801L; REDD-2
UniProt Entry Name
DDT4L_HUMAN

Uniprot Description

DDIT4L: Inhibits cell growth by regulating the TOR signaling pathway upstream of the TSC1-TSC2 complex and downstream of AKT1. Belongs to the DDIT4 family.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 4q24

Cellular Component: cytoplasm

Biological Process: negative regulation of signal transduction

Research Articles on DDIT4L

Similar Products

Product Notes

The DDIT4L ddit4l (Catalog #AAA6375844) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DDIT4L (REDD2, RTP801L, DNA Damage-inducible Transcript 4-like Protein, HIF-1 Responsive Protein RTP801-like, Protein Regulated in Development and DNA Damage Response 2) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DDIT4L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DDIT4L ddit4l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DDIT4L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.