Western Blot (WB)
(Host: RabbitTarget Name: DDIT4LSample Tissue: Human 721_BAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human DDIT4L Polyclonal Antibody | anti-DDIT4L antibody
DDIT4L Antibody - middle region
Gene Names
DDIT4L; REDD2; Rtp801L
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
DDIT4L; Polyclonal Antibody; DDIT4L Antibody - middle region; anti-DDIT4L antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 23% sucrose.
Sequence
Synthetic peptide located within the following region: ESTCQNLVKMLENCLSKSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTEP
Sequence Length
193
Applicable Applications for anti-DDIT4L antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DDT4L
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: DDIT4LSample Tissue: Human 721_BAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: DDIT4LSample Tissue: Human 721_BAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: DDT4LSample Tissue: RPMI8226 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: DDT4LSample Tissue: RPMI8226 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: DDT4LSample Type: 293T Whole Cell lysatesAntibody Dilution: 0.1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: DDT4LSample Type: 293T Whole Cell lysatesAntibody Dilution: 0.1ug/ml)
Related Product Information for anti-DDIT4L antibody
This is a rabbit polyclonal antibody against DDIT4L. It was validated on Western Blot using a cell lysate as a positive control.
Product Categories/Family for anti-DDIT4L antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21 kDa
NCBI Official Full Name
DNA damage-inducible transcript 4-like protein
NCBI Official Synonym Full Names
DNA damage inducible transcript 4 like
NCBI Official Symbol
DDIT4L
NCBI Official Synonym Symbols
REDD2; Rtp801L
NCBI Protein Information
DNA damage-inducible transcript 4-like protein
UniProt Protein Name
DNA damage-inducible transcript 4-like protein
Protein Family
UniProt Gene Name
DDIT4L
UniProt Synonym Gene Names
REDD2; RTP801L; REDD-2
UniProt Entry Name
DDT4L_HUMAN
Uniprot Description
DDIT4L: Inhibits cell growth by regulating the TOR signaling pathway upstream of the TSC1-TSC2 complex and downstream of AKT1. Belongs to the DDIT4 family.
Protein type: Unknown function
Chromosomal Location of Human Ortholog: 4q24
Cellular Component: cytoplasm
Biological Process: negative regulation of signal transduction
Research Articles on DDIT4L
Similar Products
Product Notes
The DDIT4L ddit4l (Catalog #AAA3210994) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DDIT4L Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DDIT4L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DDIT4L ddit4l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ESTCQNLVKM LENCLSKSKQ TKLGCSKVLV PEKLTQRIAQ DVLRLSSTEP. It is sometimes possible for the material contained within the vial of "DDIT4L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
