Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DDHD2 Antibody Titration: 0.2-1 ug/mlPositive Control: THP-1 cell lysate)

Rabbit DDHD2 Polyclonal Antibody | anti-DDHD2 antibody

DDHD2 antibody - N-terminal region

Gene Names
DDHD2; SPG54; SAMWD1; iPLA(1)gamma
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DDHD2; Polyclonal Antibody; DDHD2 antibody - N-terminal region; anti-DDHD2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DGWGSTPTEQGRPRTVKRGVENISVDIHCGEPLQIDHLVFVVHGIGPACD
Sequence Length
711
Applicable Applications for anti-DDHD2 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human DDHD2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DDHD2 Antibody Titration: 0.2-1 ug/mlPositive Control: THP-1 cell lysate)

Western Blot (WB) (WB Suggested Anti-DDHD2 Antibody Titration: 0.2-1 ug/mlPositive Control: THP-1 cell lysate)
Related Product Information for anti-DDHD2 antibody
This is a rabbit polyclonal antibody against DDHD2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DDHD2 is a phospholipase that hydrolyzes preferentially phosphatidic acid and phosphatidylethanolamine.DDHD2 may be involved in the maintenance of the endoplasmic reticulum and/or Golgi structures.
Product Categories/Family for anti-DDHD2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
81kDa
NCBI Official Full Name
phospholipase DDHD2 isoform 1
NCBI Official Synonym Full Names
DDHD domain containing 2
NCBI Official Symbol
DDHD2
NCBI Official Synonym Symbols
SPG54; SAMWD1; iPLA(1)gamma
NCBI Protein Information
phospholipase DDHD2
UniProt Protein Name
Phospholipase DDHD2
Protein Family
UniProt Gene Name
DDHD2
UniProt Synonym Gene Names
KIAA0725; SAMWD1

NCBI Description

This gene encodes a phospholipase enzyme containing sterile-alpha-motif (SAM), WWE, and DDHD domains. This protein participates in membrane trafficking between the endoplastic reticulum and the Golgi body. Mutations in this gene can cause autosomal recessive spastic paraplegia 54. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013]

Uniprot Description

DDHD2: Phospholipase that hydrolyzes preferentially phosphatidic acid and phosphatidylethanolamine. May be involved in the maintenance of the endoplasmic reticulum and/or Golgi structures. Belongs to the PA-PLA1 family.

Protein type: EC 3.1.1.-; Hydrolase

Chromosomal Location of Human Ortholog: 8p11.23

Cellular Component: COPII-coated ER to Golgi transport vesicle; cytosol; endoplasmic reticulum-Golgi intermediate compartment; membrane; microtubule organizing center

Molecular Function: metal ion binding; phospholipase activity; triacylglycerol lipase activity

Biological Process: ER to Golgi vesicle-mediated transport; locomotory behavior; phosphatidic acid biosynthetic process; triglyceride catabolic process; visual learning

Disease: Spastic Paraplegia 54, Autosomal Recessive

Research Articles on DDHD2

Similar Products

Product Notes

The DDHD2 ddhd2 (Catalog #AAA3212098) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DDHD2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DDHD2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DDHD2 ddhd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DGWGSTPTEQ GRPRTVKRGV ENISVDIHCG EPLQIDHLVF VVHGIGPACD. It is sometimes possible for the material contained within the vial of "DDHD2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.