Western Blot (WB)
(Host: RabbitTarget Name: DDA1Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit DDA1 Polyclonal Antibody | anti-DDA1 antibody
DDA1 Antibody - N-terminal region
Gene Names
DDA1; PCIA1; C19orf58
Applications
Western Blot
Purity
Affinity purified
Synonyms
DDA1; Polyclonal Antibody; DDA1 Antibody - N-terminal region; anti-DDA1 antibody
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ADAKQFAAIQKEQLKQQSDELPASPDDSDNSVSESLDEFDYSVAEISRSF
Sequence Length
11
Applicable Applications for anti-DDA1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human DDA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: DDA1Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: DDA1Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-DDA1 antibody
May be involved in ubiquitination and subsequent proteasomal degradation of target proteins. Component of the DDD-E2 complexes which may provide a platform for interaction with CUL4A and WD repeat proteins.
Product Categories/Family for anti-DDA1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
102
NCBI Official Full Name
DET1- and DDB1-associated protein 1
NCBI Official Synonym Full Names
DET1 and DDB1 associated 1
NCBI Official Symbol
DDA1
NCBI Official Synonym Symbols
PCIA1; C19orf58
NCBI Protein Information
DET1- and DDB1-associated protein 1
UniProt Protein Name
DET1- and DDB1-associated protein 1
Protein Family
UniProt Gene Name
DDA1
UniProt Synonym Gene Names
C19orf58; PCIA1; PCIA-1
UniProt Entry Name
DDA1_HUMAN
Uniprot Description
DDA1: May be involved in ubiquitination and subsequent proteasomal degradation of target proteins. Component of the DDD- E2 complexes which may provide a platform for interaction with CUL4A and WD repeat proteins. Belongs to the DDA1 family.
Protein type: Ubiquitin conjugating system; Autophagy
Chromosomal Location of Human Ortholog: 19p13.11
Research Articles on DDA1
Similar Products
Product Notes
The DDA1 dda1 (Catalog #AAA3221950) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's DDA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DDA1 dda1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ADAKQFAAIQ KEQLKQQSDE LPASPDDSDN SVSESLDEFD YSVAEISRSF. It is sometimes possible for the material contained within the vial of "DDA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
