Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human DC-SIGN Polyclonal Antibody | anti-DC-SIGN antibody

Anti-Human DC-SIGN DyLight 488 conjugated Antibody

Gene Names
CD209; CDSIGN; CLEC4L; DC-SIGN; DC-SIGN1
Reactivity
Human
Applications
Flow Cytometry, Functional Assay
Purity
Immunogen Affinity Purified
Synonyms
DC-SIGN; Polyclonal Antibody; Anti-Human DC-SIGN DyLight 488 conjugated Antibody; Rabbit IgG Polyclonal Anti-Human DC-SIGN Antibody DyLight 488 Conjugated; Flow Validated; CD209 antigen; C-type lectin domain family 4 member L; Dendritic cell-specific ICAM-3-grabbing non-integrin 1; DC-SIGN1; CD209; CLEC4L; CD209 molecule; anti-DC-SIGN antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen Affinity Purified
Form/Format
Liquid
Sequence Length
398
Applicable Applications for anti-DC-SIGN antibody
Flow Cytometry (FC/FACS)
Application Notes
FC/FACS: 1-3ug/1x106 cells
Immunogen
A synthetic peptide corresponding to a sequence of human DC-SIGN (MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLA).
Preparation and Storage
Store at 2-8 degree C for one year. Protect from light. Do not freeze.
Related Product Information for anti-DC-SIGN antibody
DC-SIGN (Dendritic Cell-Specific Intercellular adhesion molecule-3-Grabbing Non-integrin) also known as CD209 (Cluster of Differentiation 209) is a protein which in humans is encoded by the CD209 gene. This gene encodes a transmembrane receptor and is often referred to as DC-SIGN because of its expression on the surface of dendritic cells and macrophages. The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses with a large impact on public health. The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain. The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells. The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity. Variations in the number of 23 amino acid repeats in the neck domain of this protein are rare but have a significant impact on ligand binding ability. This gene is closely related in terms of both sequence and function to a neighboring gene. DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution. Alternative splicing results in multiple variants.
References
1. Barreiro, L. B., Neyrolles, O., Babb, C. L., Tailleux, L., Quach, H., McElreavey, K., van Helden, P. D., Hoal, E. G., Gicquel, B., Quintana-Murci, L. Promoter variation in the DC-SIGN-encoding gene CD209 is associated with tuberculosis. PLoS Med. 3: e20, 2006. 2. Bashirova, A. A., Wu, L., Cheng, J., Martin, T. D., Martin, M. P., Benveniste, R. E., Lifson, J. D., KewalRamani, V. N., Hughes, A., Carrington, M. Novel member of the CD209 (DC-SIGN) gene family in primates. J. Virol. 77: 217-227, 2003.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
45,031 Da
NCBI Official Full Name
CD209 antigen isoform 5
NCBI Official Synonym Full Names
CD209 molecule
NCBI Official Symbol
CD209
NCBI Official Synonym Symbols
CDSIGN; CLEC4L; DC-SIGN; DC-SIGN1
NCBI Protein Information
CD209 antigen
UniProt Protein Name
CD209 antigen
UniProt Gene Name
CD209
UniProt Synonym Gene Names
CLEC4L; DC-SIGN; DC-SIGN1

NCBI Description

This gene encodes a transmembrane receptor and is often referred to as DC-SIGN because of its expression on the surface of dendritic cells and macrophages. The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses with a large impact on public health. The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain. The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells. The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity. Variations in the number of 23 amino acid repeats in the neck domain of this protein are rare but have a significant impact on ligand binding ability. This gene is closely related in terms of both sequence and function to a neighboring gene (GeneID 10332; often referred to as L-SIGN). DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution. Alternative splicing results in multiple variants.[provided by RefSeq, Feb 2009]

Uniprot Description

Pathogen-recognition receptor expressed on the surface of immature dendritic cells (DCs) and involved in initiation of primary immune response. Thought to mediate the endocytosis of pathogens which are subsequently degraded in lysosomal compartments. The receptor returns to the cell membrane surface and the pathogen-derived antigens are presented to resting T-cells via MHC class II proteins to initiate the adaptive immune response.

Research Articles on DC-SIGN

Similar Products

Product Notes

The DC-SIGN cd209 (Catalog #AAA1751300) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-Human DC-SIGN DyLight 488 conjugated Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DC-SIGN can be used in a range of immunoassay formats including, but not limited to, Flow Cytometry (FC/FACS). FC/FACS: 1-3ug/1x106 cells. Researchers should empirically determine the suitability of the DC-SIGN cd209 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DC-SIGN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.