Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (DBT rabbit polyclonal antibody. Western Blot analysis of DBT expression in human kidney.)

Rabbit anti-Human DBT Polyclonal Antibody | anti-DBT antibody

DBT (Lipoamide Acyltransferase Component Of Branched-chain alpha-keto Acid Dehydrogenase Complex, Mitochondrial, Dihydrolipoyllysine-residue (2-methylpropanoyl)Transferase, Dihydrolipoamide Branched Chain Transacylase, Dihydrolipoamide Acetyltransferase C

Gene Names
DBT; E2; E2B; BCATE2; BCKADE2; BCKAD-E2; BCOADC-E2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DBT; Polyclonal Antibody; DBT (Lipoamide Acyltransferase Component Of Branched-chain alpha-keto Acid Dehydrogenase Complex; Mitochondrial; Dihydrolipoyllysine-residue (2-methylpropanoyl)Transferase; Dihydrolipoamide Branched Chain Transacylase; Dihydrolipoamide Acetyltransferase C; anti-DBT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human DBT.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
2399
Applicable Applications for anti-DBT antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human DBT, aa1-482 (AAH16675.1).
Immunogen Sequence
MAAVRMLRTWSRNAGKLICVRYFQTCGNVHVLKPNYVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIETEALKDSEEDVVETPAVSHDEHTHQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQTGAILPPSPKVEIMPPPPKPKDMTVPILVSKPPVFTGKDKTEPIKGFQKAMVKTMSAALKIPHFGYCDEIDLTELVKLREELKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQICSIFDIATELNRLQKLGSVGQLSTTDLTGGTFTLSNIGSIGGTFAKPVIMPPEVAIGALGSIKAIPRFNQKGEVYKAQIMNVSWSADHRVIDGATMSRFSNLWKSYLENPAFMLLDLK
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(DBT rabbit polyclonal antibody. Western Blot analysis of DBT expression in human kidney.)

Western Blot (WB) (DBT rabbit polyclonal antibody. Western Blot analysis of DBT expression in human kidney.)

Western Blot (WB)

(DBT rabbit polyclonal antibody. Western Blot analysis of DBT expression in A-431.)

Western Blot (WB) (DBT rabbit polyclonal antibody. Western Blot analysis of DBT expression in A-431.)

Western Blot (WB)

(Western Blot analysis of DBT expression in transfected 293T cell line by DBT polyclonal antibody. Lane 1: DBT transfected lysate (53.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of DBT expression in transfected 293T cell line by DBT polyclonal antibody. Lane 1: DBT transfected lysate (53.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-DBT antibody
DBT is the transacylase (E2) subunit. The branched-chain alpha-keto acid dehydrogenase complex (BCKD) is an inner-mitochondrial enzyme complex involved in the breakdown of the branched-chain amino acids isoleucine, leucine, and valine. The BCKD complex is thought to be composed of a core of 24 transacylase (E2) subunits, and associated decarboxylase (E1), dehydrogenase (E3), and regulatory subunits.
Product Categories/Family for anti-DBT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens dihydrolipoamide branched chain transacylase E2, mRNA
NCBI Official Synonym Full Names
dihydrolipoamide branched chain transacylase E2
NCBI Official Symbol
DBT
NCBI Official Synonym Symbols
E2; E2B; BCATE2; BCKADE2; BCKAD-E2; BCOADC-E2
NCBI Protein Information
lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial

NCBI Description

The branched-chain alpha-keto acid dehydrogenase complex (BCKD) is an inner-mitochondrial enzyme complex involved in the breakdown of the branched-chain amino acids isoleucine, leucine, and valine. The BCKD complex is thought to be composed of a core of 24 transacylase (E2) subunits, and associated decarboxylase (E1), dehydrogenase (E3), and regulatory subunits. This gene encodes the transacylase (E2) subunit. Mutations in this gene result in maple syrup urine disease, type 2. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Jul 2008]

Research Articles on DBT

Similar Products

Product Notes

The DBT (Catalog #AAA6375690) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DBT (Lipoamide Acyltransferase Component Of Branched-chain alpha-keto Acid Dehydrogenase Complex, Mitochondrial, Dihydrolipoyllysine-residue (2-methylpropanoyl)Transferase, Dihydrolipoamide Branched Chain Transacylase, Dihydrolipoamide Acetyltransferase C reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DBT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DBT for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DBT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.