Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Immunohistochemistry with Brain, cerebellum tissue at an antibody concentration of 5ug/ml using anti-DBI antibody )

Rabbit DBI Polyclonal Antibody | anti-DBI antibody

DBI antibody - N-terminal region

Gene Names
DBI; EP; ACBP; ACBD1; CCK-RP
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
DBI; Polyclonal Antibody; DBI antibody - N-terminal region; anti-DBI antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDF
Sequence Length
87
Applicable Applications for anti-DBI antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 86%; Dog: 79%; Guinea Pig: 92%; Human: 100%; Mouse: 85%; Rabbit: 86%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human DBI
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Immunohistochemistry with Brain, cerebellum tissue at an antibody concentration of 5ug/ml using anti-DBI antibody )

Immunohistochemistry (IHC) (Immunohistochemistry with Brain, cerebellum tissue at an antibody concentration of 5ug/ml using anti-DBI antibody )

Western Blot (WB)

(Host: RabbitTarget Name: DBISample Tissue: Human Ovary TumorAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: DBISample Tissue: Human Ovary TumorAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: DBISample Tissue: Human Ovary TumorAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: DBISample Tissue: Human Ovary TumorAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-DBI Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-DBI Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Liver)
Related Product Information for anti-DBI antibody
This is a rabbit polyclonal antibody against DBI. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DBI is diazepam binding inhibitor. The protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. DBI is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis. Three pseudogenes located on chromosomes 6, 8 and 16 have been identified. Multiple transcript variants encoding different isoforms have been described for this gene. This gene encodes diazepam binding inhibitor, a protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. The protein is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis. Three pseudogenes located on chromosomes 6, 8 and 16 have been identified. Multiple transcript variants encoding different isoforms have been described for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10kDa
NCBI Official Full Name
acyl-CoA-binding protein isoform 3
NCBI Official Synonym Full Names
diazepam binding inhibitor, acyl-CoA binding protein
NCBI Official Symbol
DBI
NCBI Official Synonym Symbols
EP; ACBP; ACBD1; CCK-RP
NCBI Protein Information
acyl-CoA-binding protein
UniProt Protein Name
Acyl-CoA-binding protein
Protein Family
UniProt Gene Name
DBI
UniProt Synonym Gene Names
ACBP; DBI; EP
UniProt Entry Name
ACBP_HUMAN

NCBI Description

This gene encodes diazepam binding inhibitor, a protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. The protein is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis. Three pseudogenes located on chromosomes 6, 8 and 16 have been identified. Multiple transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

DBI: Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor. Belongs to the ACBP family. 6 isoforms of the human protein are produced by alternative promoter.

Protein type: Lipid-binding

Chromosomal Location of Human Ortholog: 2q12-q21

Cellular Component: Golgi apparatus; mitochondrion; endoplasmic reticulum

Molecular Function: protein dimerization activity; benzodiazepine receptor binding; lipid binding

Biological Process: learning and/or memory; protein palmitoylation; triacylglycerol metabolic process; behavioral fear response; hair follicle development; transport; lateral ventricle development

Research Articles on DBI

Similar Products

Product Notes

The DBI dbi (Catalog #AAA3201349) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DBI antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DBI can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the DBI dbi for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSQAEFEKAA EEVRHLKTKP SDEEMLFIYG HYKQATVGDI NTERPGMLDF. It is sometimes possible for the material contained within the vial of "DBI, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.