Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: DAGLASample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit DAGLA Polyclonal Antibody | anti-DAGLA antibody

DAGLA Antibody - C-terminal region

Gene Names
DAGLA; NSDDR; C11orf11; DAGLALPHA; DAGL(ALPHA)
Applications
Western Blot
Purity
Affinity purified
Synonyms
DAGLA; Polyclonal Antibody; DAGLA Antibody - C-terminal region; anti-DAGLA antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YQPAKPTPLPRKRSEASPHENTNHKSPHKNSISLKEQEESLGSPVHHSPF
Sequence Length
114
Applicable Applications for anti-DAGLA antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human DAGLA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: DAGLASample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: DAGLASample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-DAGLA antibody
This gene encodes a diacylglycerol lipase. The encoded enzyme is involved in the biosynthesis of the endocannabinoid 2-arachidonoyl-glycerol.
Product Categories/Family for anti-DAGLA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
747
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
1042
NCBI Official Full Name
sn1-specific diacylglycerol lipase alpha
NCBI Official Synonym Full Names
diacylglycerol lipase alpha
NCBI Official Symbol
DAGLA
NCBI Official Synonym Symbols
NSDDR; C11orf11; DAGLALPHA; DAGL(ALPHA)
NCBI Protein Information
sn1-specific diacylglycerol lipase alpha
UniProt Protein Name
Sn1-specific diacylglycerol lipase alpha
UniProt Gene Name
DAGLA
UniProt Synonym Gene Names
C11orf11; KIAA0659; NSDDR; DGL-alpha
UniProt Entry Name
DGLA_HUMAN

NCBI Description

This gene encodes a diacylglycerol lipase. The encoded enzyme is involved in the biosynthesis of the endocannabinoid 2-arachidonoyl-glycerol.[provided by RefSeq, Nov 2010]

Uniprot Description

NSDDR: Catalyzes the hydrolysis of diacylglycerol (DAG) to 2- arachidonoyl-glycerol (2-AG), the most abundant endocannabinoid in tissues. Required for axonal growth during development and for retrograde synaptic signaling at mature synapses. Defects in DAGLA may be a cause of spinocerebellar ataxia type 20 (SCA20). Spinocerebellar ataxia is a clinically and genetically heterogeneous group of cerebellar disorders. Patients show progressive incoordination of gait and often poor coordination of hands, speech and eye movements, due to degeneration of the cerebellum with variable involvement of the brainstem and spinal cord. SCA20 is an autosomal dominant, adult- onset form characterized by dysarthria due to spasmodic dysphonia followed by slowly progressive ataxia. A copy number variation consisting of a 260-kb duplication at chromosome 11q12.2-12.3 is responsible for SCA20. The critical gene within the duplicated segment may be DAGLA. Belongs to the AB hydrolase superfamily. Lipase family.

Protein type: Membrane protein, integral; EC 3.1.1.-; Membrane protein, multi-pass; Hydrolase

Chromosomal Location of Human Ortholog: 11q12.2

Cellular Component: plasma membrane; integral to membrane

Molecular Function: metal ion binding; lipase activity

Biological Process: platelet activation; neuroblast proliferation; arachidonic acid metabolic process; diacylglycerol catabolic process; blood coagulation; neurotransmitter biosynthetic process

Research Articles on DAGLA

Similar Products

Product Notes

The DAGLA dagla (Catalog #AAA3222053) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's DAGLA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DAGLA dagla for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YQPAKPTPLP RKRSEASPHE NTNHKSPHKN SISLKEQEES LGSPVHHSPF. It is sometimes possible for the material contained within the vial of "DAGLA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.