<
Western Blot (WB)
(Host: RabbitTarget Name: CYTBSample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)
Rabbit CYTB Polyclonal Antibody | anti-CYTB antibody
CYTB antibody - N-terminal region
Gene Names
MT-CYB; MTCYB; CYTB
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CYTB; Polyclonal Antibody; CYTB antibody - N-terminal region; anti-CYTB antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TPMRKINPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFL
Sequence Length
378
Applicable Applications for anti-CYTB antibody
Western Blot (WB)
Homology
Human: 100%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CYTB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: CYTBSample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: CYTBSample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: CYTBSample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: CYTBSample Tissue: Human MCF7 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: CYTBSample Tissue: Human OVCAR-3 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: CYTBSample Tissue: Human OVCAR-3 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: CYTBSample Type: MCF7Lane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 0.12)
Western Blot (WB)
(Host: RabbitTarget Name: CYTBSample Type: MCF7Lane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 0.12)
Western Blot (WB)
(WB Suggested Anti-CYTB Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysate)
Western Blot (WB)
(WB Suggested Anti-CYTB Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysate)
Related Product Information for anti-CYTB antibody
This is a rabbit polyclonal antibody against CYTB. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: CYTB belongs to the cytochrome b family. It is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis.
Target Description: CYTB belongs to the cytochrome b family. It is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis.
Product Categories/Family for anti-CYTB antibody
NCBI and Uniprot Product Information
Research Articles on CYTB
Similar Products
Product Notes
The CYTB (Catalog #AAA3209863) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CYTB antibody - N-terminal region reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CYTB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CYTB for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TPMRKINPLM KLINHSFIDL PTPSNISAWW NFGSLLGACL ILQITTGLFL. It is sometimes possible for the material contained within the vial of "CYTB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
