Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CYP7A1Sample Tissue: Human NCI-H226 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CYP7A1 Polyclonal Antibody | anti-CYP7A1 antibody

CYP7A1 Antibody - middle region

Gene Names
CYP7A1; CP7A; CYP7; CYPVII
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CYP7A1; Polyclonal Antibody; CYP7A1 Antibody - middle region; anti-CYP7A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IALYPQLMHLDPEIYPDPLTFKYDRYLDENGKTKTTFYCNGLKLKYYYMP
Sequence Length
504
Applicable Applications for anti-CYP7A1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CYP7A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CYP7A1Sample Tissue: Human NCI-H226 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CYP7A1Sample Tissue: Human NCI-H226 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CYP7A1 antibody
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum membrane protein catalyzes the first reaction in the cholesterol catabolic pathway in the liver, which converts cholesterol to bile acids. This reaction is the rate limiting step and the major site of regulation of bile acid synthesis, which is the primary mechanism for the removal of cholesterol from the body. Polymorphisms in the promoter of this gene are associated with defects in bile acid synthesis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55 kDa
NCBI Official Full Name
cholesterol 7-alpha-monooxygenase
NCBI Official Synonym Full Names
cytochrome P450 family 7 subfamily A member 1
NCBI Official Symbol
CYP7A1
NCBI Official Synonym Symbols
CP7A; CYP7; CYPVII
NCBI Protein Information
cholesterol 7-alpha-monooxygenase
UniProt Protein Name
Cholesterol 7-alpha-monooxygenase
UniProt Gene Name
CYP7A1
UniProt Synonym Gene Names
CYP7
UniProt Entry Name
CP7A1_HUMAN

NCBI Description

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum membrane protein catalyzes the first reaction in the cholesterol catabolic pathway in the liver, which converts cholesterol to bile acids. This reaction is the rate limiting step and the major site of regulation of bile acid synthesis, which is the primary mechanism for the removal of cholesterol from the body. Polymorphisms in the promoter of this gene are associated with defects in bile acid synthesis. [provided by RefSeq, Feb 2010]

Uniprot Description

CYP7A1: Catalyzes a rate-limiting step in cholesterol catabolism and bile acid biosynthesis by introducing a hydrophilic moiety at position 7 of cholesterol. Important for cholesterol homeostasis. Belongs to the cytochrome P450 family.

Protein type: Lipid Metabolism - primary bile acid biosynthesis; Endoplasmic reticulum; Oxidoreductase; EC 1.14.13.17

Chromosomal Location of Human Ortholog: 8q11-q12

Cellular Component: endoplasmic reticulum membrane; intracellular membrane-bound organelle

Molecular Function: cholesterol 7-alpha-monooxygenase activity; iron ion binding; heme binding

Biological Process: bile acid biosynthetic process; cholesterol homeostasis; bile acid metabolic process; xenobiotic metabolic process; cellular lipid metabolic process; cholesterol catabolic process; sterol metabolic process; transmembrane transport

Research Articles on CYP7A1

Similar Products

Product Notes

The CYP7A1 cyp7a1 (Catalog #AAA3221026) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CYP7A1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CYP7A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CYP7A1 cyp7a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IALYPQLMHL DPEIYPDPLT FKYDRYLDEN GKTKTTFYCN GLKLKYYYMP. It is sometimes possible for the material contained within the vial of "CYP7A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.