Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (CYP4X1 rabbit polyclonal antibody. Western Blot analysis of CYP4X1 expression in human kidney.)

Rabbit anti-Human CYP4X1 Polyclonal Antibody | anti-CYP4X1 antibody

CYP4X1 (CYPIVX1, Cytochrome P450 4X1, UNQ1929/PRO4404)

Gene Names
CYP4X1; CYPIVX1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
CYP4X1; Polyclonal Antibody; CYP4X1 (CYPIVX1; Cytochrome P450 4X1; UNQ1929/PRO4404); Anti -CYP4X1 (CYPIVX1; anti-CYP4X1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CYP4X1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MEFSWLETRWARPFYLAFVFCLALGLLQAIKLYLRRQRLLRDLRPFPAPPTHWFLGHQKFIQDDNMEKLEEIIEKYPRAFPFWIGPFQAFFCIYDPDYAKTLLSRTDPKSQYLQKFSPPLLGKGLAALDGPKWFQHRRLLTPGFHFNILKAYIEVMAHSVKMMLDKWEKICSTQDTSVEVYEHINSMSLDIIMKCAFSKETNCQTNSTHDPYAKAIFELSKIIFHRLYSLLYHSDIIFKLSPQGYRFQKLSRVLNQYTDTIIQERKKSLQAGVKQDNTPKRKYQDFLDIVLSAKDESGSSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNPEHQERCREEVRGILGDGSSITWDQLGEMSYTTMCIKETCRLIPAVPSISRDLSKPLTFPDGCTLPAGITVVLSIWGLHHNPAVWKNPKVFDPLRFSQENSDQRHPYAYLPFSAGSRNCIGQEFAMIELKVTIALILLHFRVTPDPTRPLTFPNHFILKPKNGMYLHLKKLSEC
Applicable Applications for anti-CYP4X1 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human CYP4X1, aa1-509 (NP_828847.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(CYP4X1 rabbit polyclonal antibody. Western Blot analysis of CYP4X1 expression in human kidney.)

Western Blot (WB) (CYP4X1 rabbit polyclonal antibody. Western Blot analysis of CYP4X1 expression in human kidney.)

Western Blot (WB)

(Western Blot analysis of CYP4X1 expression in transfected 293T cell line by CYP4X1 polyclonal antibody. Lane 1: CYP4X1 transfected lysate (58.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CYP4X1 expression in transfected 293T cell line by CYP4X1 polyclonal antibody. Lane 1: CYP4X1 transfected lysate (58.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CYP4X1 antibody
CYP4X1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The expression pattern of a similar rat protein suggests that this protein may be involved in neurovascular function in the brain.
Product Categories/Family for anti-CYP4X1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58,875 Da
NCBI Official Full Name
cytochrome P450 4X1
NCBI Official Synonym Full Names
cytochrome P450, family 4, subfamily X, polypeptide 1
NCBI Official Symbol
CYP4X1
NCBI Official Synonym Symbols
CYPIVX1
NCBI Protein Information
cytochrome P450 4X1
UniProt Protein Name
Cytochrome P450 4X1
Protein Family
UniProt Gene Name
CYP4X1
UniProt Entry Name
CP4X1_HUMAN

NCBI Description

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The expression pattern of a similar rat protein suggests that this protein may be involved in neurovascular function in the brain. [provided by RefSeq, Jul 2008]

Uniprot Description

CYP4X1: a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The expression pattern of a similar rat protein suggests that this protein may be involved in neurovascular function in the brain. [provided by RefSeq, Jul 2008]

Protein type: EC 1.14.14.1; Oxidoreductase

Chromosomal Location of Human Ortholog: 1p33|1

Cellular Component: endoplasmic reticulum membrane; integral to membrane

Molecular Function: iron ion binding; heme binding

Research Articles on CYP4X1

Similar Products

Product Notes

The CYP4X1 cyp4x1 (Catalog #AAA6005329) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CYP4X1 (CYPIVX1, Cytochrome P450 4X1, UNQ1929/PRO4404) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CYP4X1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the CYP4X1 cyp4x1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEFSWLETRW ARPFYLAFVF CLALGLLQAI KLYLRRQRLL RDLRPFPAPP THWFLGHQKF IQDDNMEKLE EIIEKYPRAF PFWIGPFQAF FCIYDPDYAK TLLSRTDPKS QYLQKFSPPL LGKGLAALDG PKWFQHRRLL TPGFHFNILK AYIEVMAHSV KMMLDKWEKI CSTQDTSVEV YEHINSMSLD IIMKCAFSKE TNCQTNSTHD PYAKAIFELS KIIFHRLYSL LYHSDIIFKL SPQGYRFQKL SRVLNQYTDT IIQERKKSLQ AGVKQDNTPK RKYQDFLDIV LSAKDESGSS FSDIDVHSEV STFLLAGHDT LAASISWILY CLALNPEHQE RCREEVRGIL GDGSSITWDQ LGEMSYTTMC IKETCRLIPA VPSISRDLSK PLTFPDGCTL PAGITVVLSI WGLHHNPAVW KNPKVFDPLR FSQENSDQRH PYAYLPFSAG SRNCIGQEFA MIELKVTIAL ILLHFRVTPD PTRPLTFPNH FILKPKNGMY LHLKKLSEC. It is sometimes possible for the material contained within the vial of "CYP4X1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.