Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CYP4F22 expression in transfected 293T cell line by CYP4F22 polyclonal antibody. Lane 1: FLJ39501 transfected lysate (58.41kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human CYP4F22 Polyclonal Antibody | anti-CYP4F22 antibody

CYP4F22 (Cytochrome P450 4F22)

Gene Names
CYP4F22; LI3; ARCI5; INLNE
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
CYP4F22; Polyclonal Antibody; CYP4F22 (Cytochrome P450 4F22); Anti -CYP4F22 (Cytochrome P450 4F22); anti-CYP4F22 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human FLJ39501.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MLPITDRLLHLLGLEKTAFRIYAVSTLLLFLLFFLFRLLLRFLRLCRSFYITCRRLRCFPQPPRRNWLLGHLGMYLPNEAGLQDEKKVLDNMHHVLLVWMGPVLPLLVLVHPDYIKPLLGASAAIAPKDDLFYGFLKPWLGDGLLLSKGDKWSRHRRLLTPAFHFDILKPYMKIFNQSADIMHAKWRHLAEGSAVSLDMFEHISLMTLDSLQKCVFSYNSNCQEKMSDYISAIIELSALSVRRQYRLHHYLDFIYYRSADGRRFRQACDMVHHFTTEVIQERRRALRQQGAEAWLKAKQGKTLDFIDVLLLARDEDGKELSDEDIRAEADTFMFEGHDTTSSGISWMLFNLAKYPEYQEKCREEIQEVMKGRELEELEWDDLTQLPFTTMCIKESLRQYPPVTLVSRQCTEDIKLPDGRIIPKGIICLVSIYGTHHNPTVWPDSKVYNPYRFDPDNPQQRSPLAYVPFSAGPRNCIGQSFAMAELRVVVALTLLRFRLSVDRTRKVRRKPELILRTENGLWLKVEPLPPRA
Applicable Applications for anti-CYP4F22 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human FLJ39501, aa1-531 (AAH69351).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CYP4F22 expression in transfected 293T cell line by CYP4F22 polyclonal antibody. Lane 1: FLJ39501 transfected lysate (58.41kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CYP4F22 expression in transfected 293T cell line by CYP4F22 polyclonal antibody. Lane 1: FLJ39501 transfected lysate (58.41kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-CYP4F22 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61,958 Da
NCBI Official Full Name
cytochrome P450 4F22
NCBI Official Synonym Full Names
cytochrome P450, family 4, subfamily F, polypeptide 22
NCBI Official Symbol
CYP4F22
NCBI Official Synonym Symbols
LI3; ARCI5; INLNE
NCBI Protein Information
cytochrome P450 4F22; cytochrome P450, family 2, subfamily E, polypeptide 2 homolog
UniProt Protein Name
Cytochrome P450 4F22
Protein Family
UniProt Gene Name
CYP4F22
UniProt Entry Name
CP4FN_HUMAN

NCBI Description

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This gene is part of a cluster of cytochrome P450 genes on chromosome 19 and encodes an enzyme thought to play a role in the 12(R)-lipoxygenase pathway. Mutations in this gene are the cause of ichthyosis lamellar type 3. [provided by RefSeq, Jul 2008]

Uniprot Description

CYP4F22: Defects in CYP4F22 are the cause of ichthyosis lamellar type 3 (LI3). LI is a non-bullous ichthyosis, a skin disorder characterized by abnormal cornification of the epidermis. It is one the most severe forms of ichthyoses apparent at birth and persisting throughout life. LI patients are born encased in a tight, shiny, translucent covering called collodion membrane. Over the first weeks of life, the collodion membrane is gradually replaced by generalized large, dark brown, plate-like scales with minimal to no erythroderma. Tautness of facial skin commonly results in ectropion, eclabium and scarring alopecia of the scalp. Common complications are severe heat intolerance and recurrent ear infections. Belongs to the cytochrome P450 family.

Protein type: Oxidoreductase; EC 1.14.14.-

Chromosomal Location of Human Ortholog: 19p13.12

Cellular Component: endoplasmic reticulum membrane

Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen; iron ion binding; heme binding; monooxygenase activity

Biological Process: xenobiotic metabolic process; icosanoid metabolic process

Disease: Ichthyosis, Congenital, Autosomal Recessive 5

Research Articles on CYP4F22

Similar Products

Product Notes

The CYP4F22 cyp4f22 (Catalog #AAA6009366) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The CYP4F22 (Cytochrome P450 4F22) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CYP4F22 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the CYP4F22 cyp4f22 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MLPITDRLLH LLGLEKTAFR IYAVSTLLLF LLFFLFRLLL RFLRLCRSFY ITCRRLRCFP QPPRRNWLLG HLGMYLPNEA GLQDEKKVLD NMHHVLLVWM GPVLPLLVLV HPDYIKPLLG ASAAIAPKDD LFYGFLKPWL GDGLLLSKGD KWSRHRRLLT PAFHFDILKP YMKIFNQSAD IMHAKWRHLA EGSAVSLDMF EHISLMTLDS LQKCVFSYNS NCQEKMSDYI SAIIELSALS VRRQYRLHHY LDFIYYRSAD GRRFRQACDM VHHFTTEVIQ ERRRALRQQG AEAWLKAKQG KTLDFIDVLL LARDEDGKEL SDEDIRAEAD TFMFEGHDTT SSGISWMLFN LAKYPEYQEK CREEIQEVMK GRELEELEWD DLTQLPFTTM CIKESLRQYP PVTLVSRQCT EDIKLPDGRI IPKGIICLVS IYGTHHNPTV WPDSKVYNPY RFDPDNPQQR SPLAYVPFSA GPRNCIGQSF AMAELRVVVA LTLLRFRLSV DRTRKVRRKP ELILRTENGL WLKVEPLPPR A. It is sometimes possible for the material contained within the vial of "CYP4F22, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.