Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CYP2B6Sample Tissue: Human PANC1 Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human CYP2B6 Polyclonal Antibody | anti-CYP2B6 antibody

CYP2B6 Antibody - N-terminal region

Gene Names
CYP2B6; CPB6; EFVM; IIB1; P450; CYP2B; CYP2B7; CYP2B7P; CYPIIB6
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CYP2B6; Polyclonal Antibody; CYP2B6 Antibody - N-terminal region; anti-CYP2B6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RHPNTHDRLPPGPRPLPLLGNLLQMDRRGLLKSFLRFREKYGDVFTVHLG
Sequence Length
167
Applicable Applications for anti-CYP2B6 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CYP2B6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CYP2B6Sample Tissue: Human PANC1 Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CYP2B6Sample Tissue: Human PANC1 Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CYP2B6 antibody
This gene, CYP2B6, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by phenobarbital. The enzyme is known to metabolize some xenobiotics, such as the anti-cancer drugs cyclophosphamide and ifosphamide. Transcript variants for this gene have been described; however, it has not been resolved whether these transcripts are in fact produced by this gene or by a closely related pseudogene, CYP2B7. Both the gene and the pseudogene are located in the middle of a CYP2A pseudogene found in a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q.
Product Categories/Family for anti-CYP2B6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56 kDa
NCBI Official Full Name
cytochrome P450 2B6
NCBI Official Synonym Full Names
cytochrome P450 family 2 subfamily B member 6
NCBI Official Symbol
CYP2B6
NCBI Official Synonym Symbols
CPB6; EFVM; IIB1; P450; CYP2B; CYP2B7; CYP2B7P; CYPIIB6
NCBI Protein Information
cytochrome P450 2B6
UniProt Protein Name
Cytochrome P450 2B6
Protein Family
UniProt Gene Name
CYP2B6
UniProt Entry Name
CP2B6_HUMAN

NCBI Description

This gene, CYP2B6, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by phenobarbital. The enzyme is known to metabolize some xenobiotics, such as the anti-cancer drugs cyclophosphamide and ifosphamide. Transcript variants for this gene have been described; however, it has not been resolved whether these transcripts are in fact produced by this gene or by a closely related pseudogene, CYP2B7. Both the gene and the pseudogene are located in the middle of a CYP2A pseudogene found in a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q. [provided by RefSeq, Jul 2008]

Uniprot Description

CYP2B6: cytochrome P450, subfamily IIB. Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics. Phosphorylation is accompanied by a decrease in enzyme activity.

Protein type: Lipid Metabolism - arachidonic acid; Cofactor and Vitamin Metabolism - retinol; Xenobiotic Metabolism - metabolism by cytochrome P450; Oxidoreductase; Xenobiotic Metabolism - drug metabolism - cytochrome P450; EC 1.14.14.1

Chromosomal Location of Human Ortholog: 19q13.2

Cellular Component: endoplasmic reticulum membrane; intracellular membrane-bound organelle; cytoplasm

Molecular Function: iron ion binding; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen; heme binding; arachidonic acid epoxygenase activity; steroid hydroxylase activity; oxygen binding; monooxygenase activity

Biological Process: steroid metabolic process; ketone metabolic process; xenobiotic metabolic process; exogenous drug catabolic process; epoxygenase P450 pathway; drug metabolic process

Disease: Efavirenz, Poor Metabolism Of

Research Articles on CYP2B6

Similar Products

Product Notes

The CYP2B6 cyp2b6 (Catalog #AAA3220217) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CYP2B6 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CYP2B6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CYP2B6 cyp2b6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RHPNTHDRLP PGPRPLPLLG NLLQMDRRGL LKSFLRFREK YGDVFTVHLG. It is sometimes possible for the material contained within the vial of "CYP2B6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.