Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-CYP26A1 Polyclonal Antibody)

Rabbit anti-Human, Mouse CYP26A1 Polyclonal Antibody | anti-CYP26A1 antibody

CYP26A1 Polyclonal Antibody

Gene Names
CYP26A1; CP26; CYP26; P450RAI; P450RAI1
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
CYP26A1; Polyclonal Antibody; CYP26A1 Polyclonal Antibody; CP26; CYP26; P450RAI; P450RAI1; cytochrome P450 26A1; anti-CYP26A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.33 mg/ml (varies by lot)
Sequence Length
497
Applicable Applications for anti-CYP26A1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 50-150 of human CYP26A1 (NP_000774.2).
Immunogen Sequence
GFPFFGETLQMVLQRRKFLQMKRRKYGFIYKTHLFGRPTVRVMGADNVRRILLGEHRLVSVHWPASVRTILGSGCLSNLHDSSHKQRKKVIMRAFSREALE
Positive Samples
HepG2
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-CYP26A1 Polyclonal Antibody)

Western Blot (WB) (Western blot-CYP26A1 Polyclonal Antibody)
Related Product Information for anti-CYP26A1 antibody
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum protein acts on retinoids, including all-trans-retinoic acid (RA), with both 4-hydroxylation and 18-hydroxylation activities. This enzyme regulates the cellular level of retinoic acid which is involved in regulation of gene expression in both embryonic and adult tissues. Two alternatively spliced transcript variants of this gene, which encode the distinct isoforms, have been reported.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 48kDa; 56kDa
Observed: 55kDa
NCBI Official Full Name
cytochrome P450 26A1 isoform 1
NCBI Official Synonym Full Names
cytochrome P450 family 26 subfamily A member 1
NCBI Official Symbol
CYP26A1
NCBI Official Synonym Symbols
CP26; CYP26; P450RAI; P450RAI1
NCBI Protein Information
cytochrome P450 26A1
UniProt Protein Name
Cytochrome P450 26A1
Protein Family
UniProt Gene Name
CYP26A1
UniProt Synonym Gene Names
CYP26; P450RAI1; Cytochrome P450RAI; hP450RAI
UniProt Entry Name
CP26A_HUMAN

NCBI Description

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum protein acts on retinoids, including all-trans-retinoic acid (RA), with both 4-hydroxylation and 18-hydroxylation activities. This enzyme regulates the cellular level of retinoic acid which is involved in regulation of gene expression in both embryonic and adult tissues. Two alternatively spliced transcript variants of this gene, which encode the distinct isoforms, have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

CYP26A1: Plays a key role in retinoic acid metabolism. Acts on retinoids, including all-trans-retinoic acid (RA) and its stereoisomer 9-cis-RA. Capable of both 4-hydroxylation and 18- hydroxylation. Responsible for generation of several hydroxylated forms of RA, including 4-OH-RA, 4-oxo-RA and 18-OH-RA. Belongs to the cytochrome P450 family.

Protein type: EC 1.14.-.-; Oxidoreductase; Cofactor and Vitamin Metabolism - retinol; Endoplasmic reticulum

Chromosomal Location of Human Ortholog: 10q23-q24

Cellular Component: endoplasmic reticulum membrane

Molecular Function: retinoic acid binding; iron ion binding; retinoic acid 4-hydroxylase activity; heme binding; oxygen binding

Biological Process: anterior/posterior pattern formation; retinoic acid receptor signaling pathway; negative regulation of retinoic acid receptor signaling pathway; vitamin metabolic process; central nervous system development; neural crest cell development; metabolic process; xenobiotic metabolic process

Research Articles on CYP26A1

Similar Products

Product Notes

The CYP26A1 cyp26a1 (Catalog #AAA9140790) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CYP26A1 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CYP26A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the CYP26A1 cyp26a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CYP26A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.