Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CYP19A1Sample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CYP19A1 Polyclonal Antibody | anti-CYP19A1 antibody

CYP19A1 Antibody - middle region

Gene Names
CYP19A1; ARO; ARO1; CPV1; CYAR; CYP19; CYPXIX; P-450AROM
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CYP19A1; Polyclonal Antibody; CYP19A1 Antibody - middle region; anti-CYP19A1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 23% sucrose.
Sequence
Synthetic peptide located within the following region: VMRKALEDDVIDGYPVKKGTNIILNIGRMHRLEFFPKPNEFTLENFAKNV
Sequence Length
503
Applicable Applications for anti-CYP19A1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CYP19A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CYP19A1Sample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CYP19A1Sample Tissue: Human MCF7 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CYP19A1 antibody
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and catalyzes the last steps of estrogen biosynthesis. Mutations in this gene can result in either increased or decreased aromatase activity; the associated phenotypes suggest that estrogen functions both as a sex steroid hormone and in growth or differentiation. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-CYP19A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55 kDa
NCBI Official Full Name
aromatase
NCBI Official Synonym Full Names
cytochrome P450 family 19 subfamily A member 1
NCBI Official Symbol
CYP19A1
NCBI Official Synonym Symbols
ARO; ARO1; CPV1; CYAR; CYP19; CYPXIX; P-450AROM
NCBI Protein Information
aromatase
UniProt Protein Name
Cytochrome P450 19A1
Protein Family
UniProt Gene Name
CYP19A1
UniProt Synonym Gene Names
ARO1; CYAR; CYP19
UniProt Entry Name
CP19A_HUMAN

NCBI Description

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and catalyzes the last steps of estrogen biosynthesis. Mutations in this gene can result in either increased or decreased aromatase activity; the associated phenotypes suggest that estrogen functions both as a sex steroid hormone and in growth or differentiation. Alternative promoter use and alternative splicing results in multiple transcript variants that have different tissue specificities. [provided by RefSeq, Dec 2016]

Uniprot Description

CYP19A1: Catalyzes the formation of aromatic C18 estrogens from C19 androgens. Belongs to the cytochrome P450 family.

Protein type: Oxidoreductase; EC 1.14.14.14; Lipid Metabolism - androgen and estrogen

Chromosomal Location of Human Ortholog: 15q21.1

Cellular Component: endoplasmic reticulum membrane; membrane; endoplasmic reticulum

Molecular Function: electron carrier activity; iron ion binding; heme binding; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen; oxygen binding

Biological Process: steroid metabolic process; xenobiotic metabolic process; androgen metabolic process; steroid biosynthetic process; estrogen biosynthetic process; sterol metabolic process

Disease: Aromatase Deficiency; Aromatase Excess Syndrome

Research Articles on CYP19A1

Similar Products

Product Notes

The CYP19A1 cyp19a1 (Catalog #AAA3221055) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CYP19A1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CYP19A1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CYP19A1 cyp19a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VMRKALEDDV IDGYPVKKGT NIILNIGRMH RLEFFPKPNE FTLENFAKNV. It is sometimes possible for the material contained within the vial of "CYP19A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.