Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-CYFIP1 AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole Cell)

Rabbit CYFIP1 Polyclonal Antibody | anti-CYFIP1 antibody

CYFIP1 Antibody - C-terminal region

Gene Names
CYFIP1; SHYC; SRA1; SRA-1; P140SRA-1
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CYFIP1; Polyclonal Antibody; CYFIP1 Antibody - C-terminal region; anti-CYFIP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WAGCMIIVLLGQQRRFAVLDFCYHLLKVQKHDGKDEIIKNVPLKKMVERI
Sequence Length
1253
Applicable Applications for anti-CYFIP1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CYFIP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-CYFIP1 AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole Cell)

Western Blot (WB) (WB Suggested Anti-CYFIP1 AntibodyTitration: 1.0 ug/mlPositive Control: COLO205 Whole Cell)
Related Product Information for anti-CYFIP1 antibody
This is a rabbit polyclonal antibody against CYFIP1. It was validated on Western Blot

Target Description: CYFIP1 is a component of the CYFIP1-EIF4E-FMR1 complex which binds to the mRNA cap and mediates translational repression. In the CYFIP1-EIF4E-FMR1 complex this subunit is an adapter between EIF4E and FMR1. CYFIP1 promotes the translation repression activity of FMR1 in brain probably by mediating its association with EIF4E and mRNA By similarity. CYFIP1 regulates formation of membrane ruffles and lamellipodia. CYFIP1 plays a role in axon outgrowth. CYFIP1 binds to F-actin but not to RNA. Part of the WAVE complex that regulates actin filament reorganization via its interaction with the Arp2/3 complex. Actin remodeling activity is regulated by RAC1. Regulator of epithelial morphogenesis. CYFIP1 may act as an invasion suppressor in cancers.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
145kDa
NCBI Official Full Name
cytoplasmic FMR1-interacting protein 1 isoform a
NCBI Official Synonym Full Names
cytoplasmic FMR1 interacting protein 1
NCBI Official Symbol
CYFIP1
NCBI Official Synonym Symbols
SHYC; SRA1; SRA-1; P140SRA-1
NCBI Protein Information
cytoplasmic FMR1-interacting protein 1
UniProt Protein Name
Cytoplasmic FMR1-interacting protein 1
UniProt Gene Name
CYFIP1
UniProt Synonym Gene Names
Sra-1
UniProt Entry Name
CYFP1_HUMAN

NCBI Description

This gene encodes a protein that regulates cytoskeletal dynamics and protein translation. The encoded protein is a component of the WAVE regulatory complex (WRC), which promotes actin polymerization.This protein also interacts with the Fragile X mental retardation protein (FMRP) and translation initiation factor 4E to inhibit protein translation. A large chromosomal deletion including this gene is associated with increased risk of schizophrenia and epilepsy in human patients. Reduced expression of this gene has been observed in various human cancers and the encoded protein may inhibit tumor invasion. [provided by RefSeq, May 2017]

Research Articles on CYFIP1

Similar Products

Product Notes

The CYFIP1 cyfip1 (Catalog #AAA3216453) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CYFIP1 Antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CYFIP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CYFIP1 cyfip1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WAGCMIIVLL GQQRRFAVLD FCYHLLKVQK HDGKDEIIKN VPLKKMVERI. It is sometimes possible for the material contained within the vial of "CYFIP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.