Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using Cyclin Y antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

Rabbit Cyclin Y Polyclonal Antibody | anti-CCNY antibody

Cyclin Y Rabbit pAb

Gene Names
CCNY; CCNX; CFP1; CBCP1; C10orf9
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
Cyclin Y; Polyclonal Antibody; Cyclin Y Rabbit pAb; C10orf9; CBCP1; CCNX; CFP1; CCNY; cyclin-Y; anti-CCNY antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
PNLKYTIKCVALAIYYHIKNRDPDGRMLLDIFDENLHPLSKSEVPPDYDKHNPEQKQIYRF
Applicable Applications for anti-CCNY antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 60-120 of human CCNY (NP_859049.2).
Positive Samples
Mouse brain, C6
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using Cyclin Y antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using Cyclin Y antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-CCNY antibody
Background: Cyclins, such as CCNY, control cell division cycles and regulate cyclin-dependent kinases (e.g., CDC2; MIM 116940)(Li et al., 2009 [PubMed 18060517]).[supplied by OMIM, May 2009]
Product Categories/Family for anti-CCNY antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
~65 kDa
NCBI Official Full Name
Homo sapiens cyclin Y (CCNY), transcript variant 1, mRNA
NCBI Official Synonym Full Names
cyclin Y
NCBI Official Symbol
CCNY
NCBI Official Synonym Symbols
CCNX; CFP1; CBCP1; C10orf9
NCBI Protein Information
cyclin-Y; cyc-Y; cyclin-X; cyclin box protein 1; cyclin fold protein 1; cyclin-box carrying protein 1
UniProt Protein Name
Cyclin-Y
UniProt Gene Name
CCNY
UniProt Synonym Gene Names
C10orf9; CBCP1; CFP1; Cyc-Y
UniProt Entry Name
CCNY_HUMAN

NCBI Description

Cyclins, such as CCNY, control cell division cycles and regulate cyclin-dependent kinases (e.g., CDC2; MIM 116940) (Li et al., 2009 [PubMed 18060517]).[supplied by OMIM, May 2009]

Uniprot Description

Function: Positive regulatory subunit of the cyclin-dependent kinases CDK14/PFTK1 and CDK16. Acts as a cell-cycle regulator of Wnt signaling pathway during G2/M phase by recruiting CDK14/PFTK1 to the plasma membrane and promoting phosphorylation of LRP6, leading to the activation of the Wnt signaling pathway. Recruits CDK16 to the plasma membrane. Isoform 3 might play a role in the activation of MYC-mediated transcription. Ref.1 Ref.2 Ref.14 Ref.18

Subunit structure: Interacts with CDK14, CDK16 and LRP6. Ref.1 Ref.14 Ref.18

Subcellular location: Cell membrane; Lipid-anchor; Cytoplasmic side Ref.1 Ref.2 Ref.14 Ref.18. Isoform 3: Nucleus Ref.1 Ref.2 Ref.14 Ref.18.

Tissue specificity: Widely expressed. Ref.2

Developmental stage: Enriched at G2/M. Ref.14

Post-translational modification: Ubiquitinated; leading to its degradation. Ref.14

Sequence similarities: Belongs to the cyclin family. Cyclin Y subfamily.Contains 1 cyclin N-terminal domain.

Sequence caution: The sequence AAH69224.1 differs from that shown. Reason: Erroneous initiation.

Research Articles on CCNY

Similar Products

Product Notes

The CCNY ccny (Catalog #AAA9143063) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Cyclin Y Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Cyclin Y can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the CCNY ccny for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PNLKYTIKCV ALAIYYHIKN RDPDGRMLLD IFDENLHPLS KSEVPPDYDK HNPEQKQIYR F. It is sometimes possible for the material contained within the vial of "Cyclin Y, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.