Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Cyclin Y antibody (MBS5301113) used at 1 ug/ml to detect target protein.)

Rabbit Cyclin Y Polyclonal Antibody | anti-CCNY antibody

Cyclin Y antibody

Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
Cyclin Y; Polyclonal Antibody; Cyclin Y antibody; Polyclonal Cyclin Y; Anti-Cyclin Y; C10orf9; CFP1; CBCP1; CCNY; anti-CCNY antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
Cyclin Y antibody was raised against the middle region of CCNY
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CCNY antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
341
Applicable Applications for anti-CCNY antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
CCNY belongs to the cyclin family, Cyclin Y subfamily. It contains 1 cyclin N-terminal domain. Single nucleotide polymorphism in CCNY gene is associated with Crohn's disease and ulcerative colitis.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
Cyclin Y antibody was raised using the middle region of CCNY corresponding to a region with amino acids DENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVY
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Cyclin Y antibody (MBS5301113) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Cyclin Y antibody (MBS5301113) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-CCNY antibody
Rabbit polyclonal Cyclin Y antibody raised against the middle region of CCNY
Product Categories/Family for anti-CCNY antibody

NCBI and Uniprot Product Information

NCBI GI #
Molecular Weight
39 kDa (MW of target protein)
NCBI Official Full Name
cyclin Y
UniProt Protein Name
Cyclin-Y
UniProt Gene Name
CCNY
UniProt Synonym Gene Names
C10orf9; CBCP1; CFP1; Cyc-Y
UniProt Entry Name
CCNY_HUMAN

Uniprot Description

CBCP1: Positive regulatory subunit of the cyclin-dependent kinase CDK14/PFTK1. Acts as a cell-cycle regulator of Wnt signaling pathway during G2/M phase by recruiting CDK14/PFTK1 to the plasma membrane and promoting phosphorylation of LRP6, leading to the activation of the Wnt signaling pathway. Isoform 3 might play a role in the activation of MYC-mediated transcription. Belongs to the cyclin family. Cyclin Y subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation

Chromosomal Location of Human Ortholog: 10p11.21

Cellular Component: plasma membrane; nucleus

Molecular Function: protein binding; cyclin-dependent protein kinase regulator activity; protein kinase binding

Biological Process: Wnt receptor signaling pathway; positive regulation of cyclin-dependent protein kinase activity; cell division; G2/M transition of mitotic cell cycle

Similar Products

Product Notes

The Cyclin Y ccny (Catalog #AAA5301113) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Cyclin Y antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Cyclin Y can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the Cyclin Y ccny for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Cyclin Y, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.