Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using Cyclin B2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

Rabbit anti-Human, Mouse Cyclin B2 Polyclonal Antibody | anti-B2 antibody

Cyclin B2 Rabbit pAb

Gene Names
CCNB2; HsT17299
Reactivity
Human, Mouse
Applications
Western Blot, Immunoprecipitation
Purity
Affinity purification
Synonyms
Cyclin B2; Polyclonal Antibody; Cyclin B2 Rabbit pAb; CCNB2; HsT17299; cyclin B2; anti-B2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MALLRRPTVSSDLENIDTGVNSKVKSHVTIRRTVLEEIGNRVTTRAAQVAKKAQNTKVPVQPTKTTNVNKQLKPTASVKPVQMEKLAPKGPSPTPEDVSM
Applicable Applications for anti-B2 antibody
Western Blot (WB), Immunoprecipitation (IP)
Application Notes
WB: 1:500-1:2000
IP: 1:50-1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Cyclin B2 (NP_004692.1).
Positive Samples
HeLa, SW480, A-431
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using Cyclin B2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using Cyclin B2 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.)
Related Product Information for anti-B2 antibody
Background: Cyclin B2 is a member of the cyclin family, specifically the B-type cyclins. The B-type cyclins, B1 and B2, associate with p34cdc2 and are essential components of the cell cycle regulatory machinery. B1 and B2 differ in their subcellular localization. Cyclin B1 co-localizes with microtubules, whereas cyclin B2 is primarily associated with the Golgi region. Cyclin B2 also binds to transforming growth factor beta RII and thus cyclin B2/cdc2 may play a key role in transforming growth factor beta-mediated cell cycle control.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
398
NCBI Official Full Name
G2/mitotic-specific cyclin-B2
NCBI Official Synonym Full Names
cyclin B2
NCBI Official Symbol
CCNB2
NCBI Official Synonym Symbols
HsT17299
NCBI Protein Information
G2/mitotic-specific cyclin-B2
UniProt Protein Name
G2/mitotic-specific cyclin-B2
Protein Family
UniProt Gene Name
CCNB2
UniProt Entry Name
CCNB2_HUMAN

NCBI Description

Cyclin B2 is a member of the cyclin family, specifically the B-type cyclins. The B-type cyclins, B1 and B2, associate with p34cdc2 and are essential components of the cell cycle regulatory machinery. B1 and B2 differ in their subcellular localization. Cyclin B1 co-localizes with microtubules, whereas cyclin B2 is primarily associated with the Golgi region. Cyclin B2 also binds to transforming growth factor beta RII and thus cyclin B2/cdc2 may play a key role in transforming growth factor beta-mediated cell cycle control. [provided by RefSeq, Jul 2008]

Uniprot Description

CCNB2: Essential for the control of the cell cycle at the G2/M (mitosis) transition. Belongs to the cyclin family. Cyclin AB subfamily.

Protein type: Cell cycle regulation

Chromosomal Location of Human Ortholog: 15q22.2

Cellular Component: microtubule cytoskeleton; nucleoplasm; centrosome; membrane; cytosol

Molecular Function: protein binding; protein kinase binding

Biological Process: mitosis; thymus development; cell division; regulation of cell cycle; in utero embryonic development; mitotic nuclear envelope disassembly; T cell homeostasis; regulation of cyclin-dependent protein kinase activity; mitotic cell cycle; G2/M transition of mitotic cell cycle; growth

Research Articles on B2

Similar Products

Product Notes

The B2 ccnb2 (Catalog #AAA9142327) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Cyclin B2 Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Cyclin B2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunoprecipitation (IP). WB: 1:500-1:2000 IP: 1:50-1:200. Researchers should empirically determine the suitability of the B2 ccnb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MALLRRPTVS SDLENIDTGV NSKVKSHVTI RRTVLEEIGN RVTTRAAQVA KKAQNTKVPV QPTKTTNVNK QLKPTASVKP VQMEKLAPKG PSPTPEDVSM. It is sometimes possible for the material contained within the vial of "Cyclin B2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.