Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CYB5R3Sample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CYB5R3 Polyclonal Antibody | anti-CYB5R3 antibody

CYB5R3 Antibody - middle region

Gene Names
CYB5R3; B5R; DIA1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CYB5R3; Polyclonal Antibody; CYB5R3 Antibody - middle region; anti-CYB5R3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FRGPSGLLVYQGKGKFAIRPDKKSNPIIRTVKSVGMIAGGTGITPMLQVI
Sequence Length
334
Applicable Applications for anti-CYB5R3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CYB5R3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CYB5R3Sample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CYB5R3Sample Tissue: Human DLD1 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CYB5R3 antibody
This gene encodes cytochrome b5 reductase, which includes a membrane-bound form in somatic cells (anchored in the endoplasmic reticulum, mitochondrial and other membranes) and a soluble form in erythrocytes. The membrane-bound form exists mainly on the cytoplasmic side of the endoplasmic reticulum and functions in desaturation and elongation of fatty acids, in cholesterol biosynthesis, and in drug metabolism. The erythrocyte form is located in a soluble fraction of circulating erythrocytes and is involved in methemoglobin reduction. The membrane-bound form has both membrane-binding and catalytic domains, while the soluble form has only the catalytic domain. Alternate splicing results in multiple transcript variants. Mutations in this gene cause methemoglobinemias.
Product Categories/Family for anti-CYB5R3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36 kDa
NCBI Official Full Name
NADH-cytochrome b5 reductase 3 isoform 1
NCBI Official Synonym Full Names
cytochrome b5 reductase 3
NCBI Official Symbol
CYB5R3
NCBI Official Synonym Symbols
B5R; DIA1
NCBI Protein Information
NADH-cytochrome b5 reductase 3
UniProt Protein Name
NADH-cytochrome b5 reductase 3
UniProt Gene Name
CYB5R3
UniProt Synonym Gene Names
DIA1; B5R
UniProt Entry Name
NB5R3_HUMAN

NCBI Description

This gene encodes cytochrome b5 reductase, which includes a membrane-bound form in somatic cells (anchored in the endoplasmic reticulum, mitochondrial and other membranes) and a soluble form in erythrocytes. The membrane-bound form exists mainly on the cytoplasmic side of the endoplasmic reticulum and functions in desaturation and elongation of fatty acids, in cholesterol biosynthesis, and in drug metabolism. The erythrocyte form is located in a soluble fraction of circulating erythrocytes and is involved in methemoglobin reduction. The membrane-bound form has both membrane-binding and catalytic domains, while the soluble form has only the catalytic domain. Alternate splicing results in multiple transcript variants. Mutations in this gene cause methemoglobinemias. [provided by RefSeq, Jan 2010]

Uniprot Description

CYB5R3: Desaturation and elongation of fatty acids, cholesterol biosynthesis, drug metabolism, and, in erythrocyte, methemoglobin reduction. Defects in CYB5R3 are the cause of methemoglobinemia CYB5R3-related (METHB-CYB5R3). A form of methemoglobinemia, a hematologic disease characterized by the presence of excessive amounts of methemoglobin in blood cells, resulting in decreased oxygen carrying capacity of the blood, cyanosis and hypoxia. There are two types of methemoglobinemia CYB5R3-related. In type 1, the defect affects the soluble form of the enzyme, is restricted to red blood cells, and causes well- tolerated methemoglobinemia. In type 2, the defect affects both the soluble and microsomal forms of the enzyme and is thus generalized, affecting red cells, leukocytes and all body tissues. Type 2 methemoglobinemia is associated with mental deficiency and other neurologic symptoms. Belongs to the flavoprotein pyridine nucleotide cytochrome reductase family. 3 isoforms of the human protein are produced by alternative promoter.

Protein type: Carbohydrate Metabolism - amino sugar and nucleotide sugar; Mitochondrial; Oxidoreductase; EC 1.6.2.2

Chromosomal Location of Human Ortholog: 22q13.2

Cellular Component: mitochondrial outer membrane; endoplasmic reticulum membrane; mitochondrion; membrane; hemoglobin complex; endoplasmic reticulum; cytoplasm; mitochondrial inner membrane; lipid particle

Molecular Function: FAD binding; cytochrome-b5 reductase activity; ADP binding; NAD binding; AMP binding

Biological Process: vitamin metabolic process; blood circulation; L-ascorbic acid metabolic process; cholesterol biosynthetic process; water-soluble vitamin metabolic process

Disease: Methemoglobinemia Due To Deficiency Of Methemoglobin Reductase

Research Articles on CYB5R3

Similar Products

Product Notes

The CYB5R3 cyb5r3 (Catalog #AAA3221852) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CYB5R3 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CYB5R3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CYB5R3 cyb5r3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FRGPSGLLVY QGKGKFAIRP DKKSNPIIRT VKSVGMIAGG TGITPMLQVI. It is sometimes possible for the material contained within the vial of "CYB5R3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.