Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit CXORF9 Polyclonal Antibody | anti-CXORF9 antibody

CXORF9 antibody

Gene Names
SASH3; SLY; 753P9; HACS2; CXorf9; SH3D6C
Applications
Western Blot
Purity
Affinity purified
Synonyms
CXORF9; Polyclonal Antibody; CXORF9 antibody; Polyclonal CXORF9; Anti-CXORF9; SLY; 753P9; Chromosome X Open Reading Frame 9; anti-CXORF9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
CXORF9 antibody was raised against the N terminal Of Cxorf9
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CXORF9 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
380
Applicable Applications for anti-CXORF9 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
The CXORF9 protein contains a Src homology-3 (SH3) domain and a sterile alpha motif (SAM), both of which are found in proteins involved in cell signaling. This protein may function as a signaling adapter protein in lymphocytes.
Cross-Reactivity
Human
Immunogen
CXORF9 antibody was raised using the N terminal Of Cxorf9 corresponding to a region with amino acids KPSSPVVSEKEFNLDDNIPEDDSGVPTPEDAGKSGKKLGKKWRAVISRTM
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for anti-CXORF9 antibody
Rabbit polyclonal CXORF9 antibody raised against the N terminal Of Cxorf9
Product Categories/Family for anti-CXORF9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
41 kDa (MW of target protein)
NCBI Official Full Name
chromosome X open reading frame 9
NCBI Official Synonym Full Names
SAM and SH3 domain containing 3
NCBI Official Symbol
SASH3
NCBI Official Synonym Symbols
SLY; 753P9; HACS2; CXorf9; SH3D6C
NCBI Protein Information
SAM and SH3 domain-containing protein 3
UniProt Protein Name
SAM and SH3 domain-containing protein 3
UniProt Gene Name
SASH3
UniProt Synonym Gene Names
CXorf9; SLY
UniProt Entry Name
SASH3_HUMAN

NCBI Description

The protein encoded by this gene contains a Src homology-3 (SH3) domain and a sterile alpha motif (SAM), both of which are found in proteins involved in cell signaling. This protein may function as a signaling adapter protein in lymphocytes.[provided by RefSeq, Sep 2009]

Uniprot Description

SLY: May function as a signaling adapter protein in lymphocytes.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: Xq26

Cellular Component: cytoplasm; nucleus

Biological Process: positive regulation of interleukin-4 production; positive regulation of immunoglobulin production; positive regulation of interferon-gamma production; homeostasis of number of cells within a tissue; positive regulation of B cell proliferation; positive regulation of interleukin-2 production; positive regulation of T cell cytokine production; positive regulation of T cell proliferation; positive regulation of CD4-positive, alpha beta T cell differentiation; positive regulation of tumor necrosis factor production; positive regulation of organ growth; positive regulation of interleukin-10 production

Similar Products

Product Notes

The CXORF9 sash3 (Catalog #AAA5300229) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CXORF9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the CXORF9 sash3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CXORF9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.