Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Flow Cytometry (FC/FACS) (Sample Type: HMEC-1 and A549 cells)

Rabbit CXCR4 Polyclonal Antibody | anti-CXCR4 antibody

CXCR4 antibody - N-terminal region

Gene Names
CXCR4; FB22; HM89; LAP3; LCR1; NPYR; WHIM; CD184; LAP-3; LESTR; NPY3R; NPYRL; WHIMS; HSY3RR; NPYY3R; D2S201E
Reactivity
Horse, Human, Mouse, Pig, Rabbit
Applications
Flow Cytometry, Functional Assay, Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
CXCR4; Polyclonal Antibody; CXCR4 antibody - N-terminal region; anti-CXCR4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Horse, Human, Mouse, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFL
Sequence Length
352
Applicable Applications for anti-CXCR4 antibody
Flow Cytometry (FC/FACS), Immunohistochemistry (IHC), Western Blot (WB)
Homology
Horse: 89%; Human: 91%; Mouse: 77%; Pig: 91%; Rabbit: 85%; Rat: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CXCR4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Flow Cytometry (FC/FACS)

(Sample Type: HMEC-1 and A549 cells)

Flow Cytometry (FC/FACS) (Sample Type: HMEC-1 and A549 cells)
Related Product Information for anti-CXCR4 antibody
This is a rabbit polyclonal antibody against CXCR4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CXCR4 is a CXC chemokine receptor specific for stromal cell-derived factor-1. The protein has 7 transmembrane regions and is located on the cell surface. It acts with the CD4 protein to support HIV entry into cells and is also highly expressed in breast cancer cells. Mutations in this gene have been associated with WHIM (warts, hypogammaglobulinemia, infections, and myelokathexis) syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.This gene encodes a CXC chemokine receptor specific for stromal cell-derived factor-1. The protein has 7 transmembrane regions and is located on the cell surface. It acts with the CD4 protein to support HIV entry into cells and is also highly expressed in breast cancer cells. Mutations in this gene have been associated with WHIM (warts, hypogammaglobulinemia, infections, and myelokathexis) syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
C-X-C chemokine receptor type 4 isoform b
NCBI Official Synonym Full Names
C-X-C motif chemokine receptor 4
NCBI Official Symbol
CXCR4
NCBI Official Synonym Symbols
FB22; HM89; LAP3; LCR1; NPYR; WHIM; CD184; LAP-3; LESTR; NPY3R; NPYRL; WHIMS; HSY3RR; NPYY3R; D2S201E
NCBI Protein Information
C-X-C chemokine receptor type 4
UniProt Protein Name
C-X-C chemokine receptor type 4
Protein Family
UniProt Gene Name
CXCR4
UniProt Synonym Gene Names
CXC-R4; CXCR-4; LESTR
UniProt Entry Name
CXCR4_HUMAN

NCBI Description

This gene encodes a CXC chemokine receptor specific for stromal cell-derived factor-1. The protein has 7 transmembrane regions and is located on the cell surface. It acts with the CD4 protein to support HIV entry into cells and is also highly expressed in breast cancer cells. Mutations in this gene have been associated with WHIM (warts, hypogammaglobulinemia, infections, and myelokathexis) syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

CXCR4: Receptor for the C-X-C chemokine CXCL12/SDF-1 that transduces a signal by increasing intracellular calcium ion levels and enhancing MAPK1/MAPK3 activation. Acts as a receptor for extracellular ubiquitin; leading to enhanced intracellular calcium ions and reduced cellular cAMP levels. Involved in hematopoiesis and in cardiac ventricular septum formation. Also plays an essential role in vascularization of the gastrointestinal tract, probably by regulating vascular branching and/or remodeling processes in endothelial cells. Involved in cerebellar development. In the CNS, could mediate hippocampal-neuron survival. Acts as a coreceptor (CD4 being the primary receptor) for HIV-1 X4 isolates and as a primary receptor for some HIV-2 isolates. Promotes Env-mediated fusion of the virus. Monomer. Can form dimers. Interacts with CD164. Interacts with HIV-1 surface protein gp120 and Tat. Interacts with ARRB2; the interaction is dependent on the C-terminal phosphorylation of CXCR4 and allows activation of MAPK1 and MAPK3. Interacts with ARRC; the interaction is dependent on the C-terminal phosphorylation of CXCR4 and modulates calcium mobilization. Interacts (via the cytoplasmic C-terminal) with ITCH (via the WW domains I and II); the interaction, enhanced by CXCL12, ubiquitinates CXCR4 and leads to its degradation. Interacts with extracellular ubiquitin. Interacts with human cytomegalovirus/HHV- 5 protein UL78. Expressed in numerous tissues, such as peripheral blood leukocytes, spleen, thymus, spinal cord, heart, placenta, lung, liver, skeletal muscle, kidney, pancreas, cerebellum, cerebral cortex and medulla (in microglia as well as in astrocytes), brain microvascular, coronary artery and umbilical cord endothelial cells. Isoform 1 is predominant in all tissues tested. Belongs to the G-protein coupled receptor 1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; GPCR, family 1; Receptor, GPCR

Chromosomal Location of Human Ortholog: 2q21

Cellular Component: cell surface; lysosome; leading edge; early endosome; cytoplasmic membrane-bound vesicle; integral to membrane; intercellular junction; growth cone; cytoplasm; late endosome; plasma membrane; cytoplasmic vesicle; external side of plasma membrane

Molecular Function: viral receptor activity; G-protein coupled receptor activity; protein binding; ubiquitin binding; ubiquitin protein ligase binding; cytokine binding; coreceptor activity; myosin light chain binding; actin binding; C-X-C chemokine receptor activity

Biological Process: entry of virus into host cell; regulation of chemotaxis; viral reproduction; activation of MAPK activity; apoptosis; neuron migration; motor axon guidance; regulation of cell migration; germ cell development; T cell proliferation; elevation of cytosolic calcium ion concentration; germ cell migration; dendritic cell chemotaxis; positive regulation of oligodendrocyte differentiation; inflammatory response; neutrophil activation; response to virus; calcium-mediated signaling; patterning of blood vessels; G-protein coupled receptor protein signaling pathway; ameboidal cell migration; myelin maintenance; response to hypoxia; entry into host cell; brain development

Disease: Whim Syndrome

Research Articles on CXCR4

Similar Products

Product Notes

The CXCR4 cxcr4 (Catalog #AAA3200294) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CXCR4 antibody - N-terminal region reacts with Horse, Human, Mouse, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's CXCR4 can be used in a range of immunoassay formats including, but not limited to, Flow Cytometry (FC/FACS), Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the CXCR4 cxcr4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MEGISIYTSD NYTEEMGSGD YDSMKEPCFR EENANFNKIF LPTIYSIIFL. It is sometimes possible for the material contained within the vial of "CXCR4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.