Rabbit anti-Human CXCL6 Polyclonal Antibody | anti-CXCL6 antibody

CXCL6 (C-X-C Motif Chemokine 6, Chemokine alpha 3, CKA-3, Granulocyte Chemotactic Protein 2, GCP-2, Small-inducible Cytokine B6, GCP2, SCYB6) (HRP)

Cat. Num. AAA6375219

• Gene Names: CXCL6; GCP2; CKA-3; GCP-2; SCYB6
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CXCL6; Polyclonal Antibody; CXCL6 (C-X-C Motif Chemokine 6; Chemokine alpha 3; CKA-3; Granulocyte Chemotactic Protein 2; GCP-2; Small-inducible Cytokine B6; GCP2; SCYB6) (HRP); anti-CXCL6 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human CXCL6.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).

• Applicable Applications for anti-CXCL6 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human CXCL6, aa1-114 (NP_002984.1).
• Immunogen Sequence: MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN
• Conjugate: HRP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CXCL6 expression in transfected 293T cell line by polyclonal antibody. Lane 1: CXCL6 transfected lysate (11.9kD). Lane 2: Non-transfected lysate.)

Product Categories/Family for anti-CXCL6 antibody

MB-Antibodies; Growth Factors; CXCL

References

1. Effect of alginate encapsulation on the cellular transcriptome of human islets. Vaithilingam V, Quayum N, Joglekar MV, Jensen J, Hardikar AA, Oberholzer J, Guillemin GJ, Tuch BE.Biomaterials. 2011 Sep 1.

NCBI and Uniprot Product Information

• NCBI GI #: 4506851
• NCBI GeneID: 6372
• NCBI Accession #: NP_002984.1
• NCBI GenBank Nucleotide #: NM_002993
• UniProt Accession #: P80162; Q4W5D4; B2R4X3
• Molecular Weight: 11,897 Da
• NCBI Official Full Name: C-X-C motif chemokine 6
• NCBI Official Synonym Full Names: chemokine (C-X-C motif) ligand 6
• NCBI Official Symbol: CXCL6
• NCBI Official Synonym Symbols: GCP2; CKA-3; GCP-2; SCYB6
• NCBI Protein Information: C-X-C motif chemokine 6; Small inducible cytokine subfamily B (Cys-X-Cys), member b; chemokine (C-X-C motif) ligand 6 (granulocyte chemotactic protein 2); chemokine alpha 3; small inducible cytokine subfamily B (Cys-X-Cys), member 6 (granulocyte chemotact
• UniProt Protein Name: C-X-C motif chemokine 6
• Protein Family: C-X-C motif chemokine
• UniProt Gene Name: CXCL6
• UniProt Synonym Gene Names: GCP2; SCYB6; CKA-3; GCP-2
• UniProt Entry Name: CXCL6_HUMAN

Uniprot Description

CXCL6: Chemotactic for neutrophil granulocytes. Belongs to the intercrine alpha (chemokine CxC) family.

Protein type: Secreted, signal peptide; Motility/polarity/chemotaxis; Secreted

Chromosomal Location of Human Ortholog: 4q13.3

Cellular Component: extracellular space; extracellular region

Molecular Function: heparin binding; chemokine activity; CXCR chemokine receptor binding

Biological Process: G-protein coupled receptor protein signaling pathway; cell-cell signaling; defense response to bacterium; neutrophil mediated immunity; response to lipopolysaccharide; positive regulation of leukocyte chemotaxis; immune response; chemotaxis; signal transduction; inflammatory response; regulation of cell proliferation