Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human CXCL3 Polyclonal Antibody | anti-CXCL3 antibody

CXCL3 antibody - middle region

Gene Names
CXCL3; GRO3; GROg; MIP2B; SCYB3; MIP-2b; CINC-2b
Reactivity
Human
Applications
Western Blot
Purity
Protein A purified
Synonyms
CXCL3; Polyclonal Antibody; CXCL3 antibody - middle region; anti-CXCL3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
Sequence Length
107
Applicable Applications for anti-CXCL3 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CXCL3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-CXCL3 antibody
This is a rabbit polyclonal antibody against CXCL3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CXCL3 may play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion.
Product Categories/Family for anti-CXCL3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11kDa
NCBI Official Full Name
C-X-C motif chemokine 3
NCBI Official Synonym Full Names
C-X-C motif chemokine ligand 3
NCBI Official Symbol
CXCL3
NCBI Official Synonym Symbols
GRO3; GROg; MIP2B; SCYB3; MIP-2b; CINC-2b
NCBI Protein Information
C-X-C motif chemokine 3
UniProt Protein Name
C-X-C motif chemokine 3
Protein Family
UniProt Gene Name
CXCL3
UniProt Synonym Gene Names
GRO3; GROG; SCYB3; GRO-gamma; MIP2-beta
UniProt Entry Name
CXCL3_HUMAN

NCBI Description

This antimicrobial gene encodes a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signals through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattractant for neutrophils. [provided by RefSeq, Sep 2014]

Uniprot Description

CXCL3: Ligand for CXCR2. Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. In vitro, the processed form GRO-gamma(5-73) shows a fivefold higher chemotactic activity for neutrophilic granulocytes. Belongs to the intercrine alpha (chemokine CxC) family.

Protein type: Motility/polarity/chemotaxis; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 4q21

Cellular Component: extracellular space; extracellular region

Molecular Function: chemokine activity; CXCR chemokine receptor binding

Biological Process: G-protein coupled receptor protein signaling pathway; neutrophil chemotaxis; positive regulation of leukocyte chemotaxis; response to lipopolysaccharide; immune response; inflammatory response; regulation of cell proliferation

Research Articles on CXCL3

Similar Products

Product Notes

The CXCL3 cxcl3 (Catalog #AAA3224417) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CXCL3 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CXCL3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CXCL3 cxcl3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QSVNVRSPGP HCAQTEVIAT LKNGKKACLN PASPMVQKII EKILNKGSTN. It is sometimes possible for the material contained within the vial of "CXCL3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.