Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (CXCL11 rabbit polyclonal antibody. Western Blot analysis of CXCL11 expression in Jurkat.)

Rabbit anti-Human, Mouse CXCL11 Polyclonal Antibody | anti-CXCL11 antibody

CXCL11 (TAC, SCYB11, SCYB9B, C-X-C Motif Chemokine 11, Beta-R1, H174, Interferon gamma-inducible Protein 9, Interferon-inducible T-cell alpha Chemoattractant, Small-inducible Cytokine B11) (PE)

Gene Names
CXCL11; IP9; H174; IP-9; b-R1; I-TAC; SCYB11; SCYB9B
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CXCL11; Polyclonal Antibody; CXCL11 (TAC; SCYB11; SCYB9B; C-X-C Motif Chemokine 11; Beta-R1; H174; Interferon gamma-inducible Protein 9; Interferon-inducible T-cell alpha Chemoattractant; Small-inducible Cytokine B11) (PE); anti-CXCL11 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CXCL11. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-CXCL11 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CXCL11, aa1-94 (NP_005400.1).
Immunogen Sequence
MSVKGMAIALAVILCATVVQGFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(CXCL11 rabbit polyclonal antibody. Western Blot analysis of CXCL11 expression in Jurkat.)

Western Blot (WB) (CXCL11 rabbit polyclonal antibody. Western Blot analysis of CXCL11 expression in Jurkat.)

Western Blot (WB)

(CXCL11 rabbit polyclonal antibody. Western Blot analysis of CXCL11 expression in NIH/3T3.)

Western Blot (WB) (CXCL11 rabbit polyclonal antibody. Western Blot analysis of CXCL11 expression in NIH/3T3.)

Western Blot (WB)

(Western Blot analysis of CXCL11 expression in transfected 293T cell line by CXCL11 polyclonal antibody. Lane 1: CXCL11 transfected lysate (10.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CXCL11 expression in transfected 293T cell line by CXCL11 polyclonal antibody. Lane 1: CXCL11 transfected lysate (10.4kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CXCL11 antibody
Chemokines are a group of small (approximately 8 to 14kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC. This gene is a CXC member of the chemokine superfamily. Its encoded protein induces a chemotactic response in activated T-cells and is the dominant ligand for CXC receptor-3. The gene encoding this protein contains 4 exons and at least three polyadenylation signals which might reflect cell-specific regulation of expression. IFN-gamma is a potent inducer of transcription of this gene.
Product Categories/Family for anti-CXCL11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10,365 Da
NCBI Official Full Name
C-X-C motif chemokine 11
NCBI Official Synonym Full Names
chemokine (C-X-C motif) ligand 11
NCBI Official Symbol
CXCL11
NCBI Official Synonym Symbols
IP9; H174; IP-9; b-R1; I-TAC; SCYB11; SCYB9B
NCBI Protein Information
C-X-C motif chemokine 11; beta-R1; small inducible cytokine B11; small-inducible cytokine B11; interferon gamma-inducible protein 9; interferon-inducible T-cell alpha chemoattractant; small inducible cytokine subfamily B (Cys-X-Cys), member 11; small indu
UniProt Protein Name
C-X-C motif chemokine 11
Protein Family
UniProt Gene Name
CXCL11
UniProt Synonym Gene Names
ITAC; SCYB11; SCYB9B; IP-9; I-TAC
UniProt Entry Name
CXL11_HUMAN

Uniprot Description

CXCL11: Chemotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses. Belongs to the intercrine alpha (chemokine CxC) family.

Protein type: Motility/polarity/chemotaxis; Chemokine; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 4q21.2

Cellular Component: extracellular space; extracellular region

Molecular Function: heparin binding; protein binding; CXCR3 chemokine receptor binding; chemokine activity

Biological Process: G-protein coupled receptor protein signaling pathway; cell-cell signaling; immune response; positive regulation of leukocyte chemotaxis; response to lipopolysaccharide; positive regulation of release of sequestered calcium ion into cytosol; positive regulation of cAMP metabolic process; signal transduction; chemotaxis; inflammatory response; regulation of cell proliferation

Similar Products

Product Notes

The CXCL11 cxcl11 (Catalog #AAA6375192) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CXCL11 (TAC, SCYB11, SCYB9B, C-X-C Motif Chemokine 11, Beta-R1, H174, Interferon gamma-inducible Protein 9, Interferon-inducible T-cell alpha Chemoattractant, Small-inducible Cytokine B11) (PE) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CXCL11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CXCL11 cxcl11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CXCL11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.