Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CX3CR1Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human CX3CR1 Polyclonal Antibody | anti-CX3CR1 antibody

CX3CR1 Antibody - C-terminal region

Gene Names
CX3CR1; V28; CCRL1; GPR13; CMKDR1; GPRV28; CMKBRL1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CX3CR1; Polyclonal Antibody; CX3CR1 Antibody - C-terminal region; anti-CX3CR1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EKFRRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTS
Sequence Length
355
Applicable Applications for anti-CX3CR1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CX3CR1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CX3CR1Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CX3CR1Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CX3CR1 antibody
This is a rabbit polyclonal antibody against CX3CR1. It was validated on Western Blot

Target Description: Fractalkine is a transmembrane protein and chemokine involved in the adhesion and migration of leukocytes. The protein encoded by this gene is a receptor for fractalkine. The encoded protein also is a coreceptor for HIV-1, and some variations in this gene lead to increased susceptibility to HIV-1 infection and rapid progression to AIDS. Four transcript variants encoding two different isoforms have been found for this gene.
Product Categories/Family for anti-CX3CR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
CX3C chemokine receptor 1 isoform b
NCBI Official Synonym Full Names
C-X3-C motif chemokine receptor 1
NCBI Official Symbol
CX3CR1
NCBI Official Synonym Symbols
V28; CCRL1; GPR13; CMKDR1; GPRV28; CMKBRL1
NCBI Protein Information
CX3C chemokine receptor 1
UniProt Protein Name
CX3C chemokine receptor 1
Protein Family
UniProt Gene Name
CX3CR1
UniProt Synonym Gene Names
CMKBRL1; GPR13; C-X3-C CKR-1; CX3CR1; CMK-BRL1
UniProt Entry Name
CX3C1_HUMAN

NCBI Description

Fractalkine is a transmembrane protein and chemokine involved in the adhesion and migration of leukocytes. The protein encoded by this gene is a receptor for fractalkine. The encoded protein also is a coreceptor for HIV-1, and some variations in this gene lead to increased susceptibility to HIV-1 infection and rapid progression to AIDS. Four transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jan 2010]

Uniprot Description

CX3CR1: Receptor for the CX3C chemokine fractalkine and mediates both its adhesive and migratory functions. Acts as coreceptor with CD4 for HIV-1 virus envelope protein (in vitro). Isoform 2 and isoform 3 seem to be more potent HIV-1 coreceptors than isoform 1. Defects in CX3CR1 are a cause of susceptibility to age- related macular degeneration type 12 (ARMD12). ARMD12 is a form of age-related macular degeneration, a multifactorial eye disease and the most common cause of irreversible vision loss in the developed world. In most patients, the disease is manifest as ophthalmoscopically visible yellowish accumulations of protein and lipid that lie beneath the retinal pigment epithelium and within an elastin-containing structure known as Bruch membrane. Belongs to the G-protein coupled receptor 1 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Cell adhesion; GPCR, family 1; Motility/polarity/chemotaxis; Receptor, GPCR; Membrane protein, multi-pass; Receptor, cytokine

Chromosomal Location of Human Ortholog: 3p21.3

Cellular Component: neuron projection; perinuclear region of cytoplasm; integral to plasma membrane; plasma membrane

Molecular Function: protein binding; chemokine receptor activity; C-X3-C chemokine receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; positive regulation of angiogenesis; negative regulation of angiogenesis; cerebral cortex cell migration; viral reproduction; response to wounding; cellular defense response; cell adhesion; chemotaxis; macrophage chemotaxis; negative regulation of cell migration; microglial cell activation during immune response

Disease: Macular Degeneration, Age-related, 12; Coronary Heart Disease, Susceptibility To, 1; Human Immunodeficiency Virus Type 1, Susceptibility To

Research Articles on CX3CR1

Similar Products

Product Notes

The CX3CR1 cx3cr1 (Catalog #AAA3219430) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CX3CR1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CX3CR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CX3CR1 cx3cr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EKFRRYLYHL YGKCLAVLCG RSVHVDFSSS ESQRSRHGSV LSSNFTYHTS. It is sometimes possible for the material contained within the vial of "CX3CR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.