Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CTSK expression in transfected 293T cell line by CTSK polyclonal antibody. Lane 1: CTSK transfected lysate (37kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human CTSK Polyclonal Antibody | anti-CTSK antibody

CTSK (Cathepsin K, Cathepsin O, Cathepsin X, Cathepsin O2, CTSO2, CTSO) (HRP)

Gene Names
CTSK; CTSO; PKND; PYCD; CTS02; CTSO1; CTSO2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
CTSK; Polyclonal Antibody; CTSK (Cathepsin K; Cathepsin O; Cathepsin X; Cathepsin O2; CTSO2; CTSO) (HRP); anti-CTSK antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CTSK.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Applicable Applications for anti-CTSK antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CTSK, aa1-329 (NP_000387.1).
Immunogen Sequence
MWGLKVLLLPVVSFALYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIHNLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CTSK expression in transfected 293T cell line by CTSK polyclonal antibody. Lane 1: CTSK transfected lysate (37kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CTSK expression in transfected 293T cell line by CTSK polyclonal antibody. Lane 1: CTSK transfected lysate (37kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-CTSK antibody
The protein encoded by this gene is a lysosomal cysteine proteinase involved in bone remodeling and resorption. This protein, which is a member of the peptidase C1 protein family, is predominantly expressed in osteoclasts. However, the encoded protein is also expressed in a significant fraction of human breast cancers, where it could contribute to tumor invasiveness. Mutations in this gene are the cause of pycnodysostosis, an autosomal recessive disease characterized by osteosclerosis and short stature. This gene may be subject to RNA editing.
Product Categories/Family for anti-CTSK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36,966 Da
NCBI Official Full Name
cathepsin K preproprotein
NCBI Official Synonym Full Names
cathepsin K
NCBI Official Symbol
CTSK
NCBI Official Synonym Symbols
CTSO; PKND; PYCD; CTS02; CTSO1; CTSO2
NCBI Protein Information
cathepsin K; cathepsin O; cathepsin X; cathepsin O1; cathepsin O2
UniProt Protein Name
Cathepsin K
Protein Family
UniProt Gene Name
CTSK
UniProt Synonym Gene Names
CTSO; CTSO2
UniProt Entry Name
CATK_HUMAN

NCBI Description

The protein encoded by this gene is a lysosomal cysteine proteinase involved in bone remodeling and resorption. This protein, which is a member of the peptidase C1 protein family, is predominantly expressed in osteoclasts. However, the encoded protein is also expressed in a significant fraction of human breast cancers, where it could contribute to tumor invasiveness. Mutations in this gene are the cause of pycnodysostosis, an autosomal recessive disease characterized by osteosclerosis and short stature. [provided by RefSeq, Apr 2013]

Uniprot Description

CTSK: Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone remodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in extracellular matrix degradation. Defects in CTSK are the cause of pycnodysostosis (PKND). PKND is an autosomal recessive osteochondrodysplasia characterized by osteosclerosis and short stature. Belongs to the peptidase C1 family.

Protein type: Protease; EC 3.4.22.38

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: extracellular space; extracellular region

Molecular Function: collagen binding; protein binding; proteoglycan binding; fibronectin binding; cysteine-type endopeptidase activity; cysteine-type peptidase activity

Biological Process: extracellular matrix disassembly; collagen catabolic process; intramembranous ossification; extracellular matrix organization and biogenesis; proteolysis involved in cellular protein catabolic process; toll-like receptor signaling pathway; innate immune response; proteolysis; bone resorption

Disease: Pycnodysostosis

Research Articles on CTSK

Similar Products

Product Notes

The CTSK ctsk (Catalog #AAA6375065) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CTSK (Cathepsin K, Cathepsin O, Cathepsin X, Cathepsin O2, CTSO2, CTSO) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CTSK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CTSK ctsk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CTSK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.