Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CTNNA3Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit CTNNA3 Polyclonal Antibody | anti-CTNNA3 antibody

CTNNA3 Antibody - N-terminal region

Gene Names
CTNNA3; VR22; ARVD13
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CTNNA3; Polyclonal Antibody; CTNNA3 Antibody - N-terminal region; anti-CTNNA3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PLIIQVTTLVNCPQNPSSRKKGRSKRASVLLASVEEATWNLLDKGEKIAQ
Sequence Length
516
Applicable Applications for anti-CTNNA3 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Pig: 85%; Rabbit: 92%; Rat: 92%; Zebrafish: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human CTNNA3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CTNNA3Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CTNNA3Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CTNNA3 antibody
This is a rabbit polyclonal antibody against CTNNA3. It was validated on Western Blot

Target Description: CTNNA3 may be involved in formation of stretch-resistant cell-cell adhesion complexes.
Product Categories/Family for anti-CTNNA3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
Catenin alpha-3
NCBI Official Synonym Full Names
catenin alpha 3
NCBI Official Symbol
CTNNA3
NCBI Official Synonym Symbols
VR22; ARVD13
NCBI Protein Information
catenin alpha-3
UniProt Protein Name
Catenin alpha-3
Protein Family
UniProt Gene Name
CTNNA3
UniProt Entry Name
CTNA3_HUMAN

NCBI Description

This gene encodes a protein that belongs to the vinculin/alpha-catenin family. The encoded protein plays a role in cell-cell adhesion in muscle cells. Mutations in this gene are associated with arrhythmogenic right ventricular dysplasia, familial 13. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014]

Uniprot Description

CTNNA3: May be involved in formation of stretch-resistant cell- cell adhesion complexes. Belongs to the vinculin/alpha-catenin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell adhesion

Chromosomal Location of Human Ortholog: 10q22.2

Cellular Component: cytoskeleton; lamellipodium; cytoplasm; fascia adherens

Molecular Function: actin filament binding; protein binding; cadherin binding

Biological Process: cell-cell adhesion

Disease: Arrhythmogenic Right Ventricular Dysplasia, Familial, 13

Research Articles on CTNNA3

Similar Products

Product Notes

The CTNNA3 ctnna3 (Catalog #AAA3216513) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CTNNA3 Antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CTNNA3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CTNNA3 ctnna3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PLIIQVTTLV NCPQNPSSRK KGRSKRASVL LASVEEATWN LLDKGEKIAQ. It is sometimes possible for the material contained within the vial of "CTNNA3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.